Rv1554 - fumarate reductase membrane anchor subunit frdC

Expression: Most Significant Conditions for Rv1554

Protein Domains

Gene Information
Locus	Rv1554
Symbol	frdC
Gene Name	fumarate reductase membrane anchor subunit frdC
Location	1760175 - 1760555 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:381 bp Protein:127 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	8991
Related Genes	MT1605
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv1554
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv1554 Transcript 1
MSAYRQPVERYWWARRRSYLRFMLREISCIFVAWFVLYLMLVLRAVGAGGNSYQRFLDFS
ANPVVVVLNVVALSFLLLHAVTWFGSAPRAMVIQVRGRRVPARAVLAGHYAAWLVVSVIV
AWMVLS*

Genomic Sequence

>Rv1554
ATGAGCGCCTATCGCCAGCCGGTCGAAAGATACTGGTGGGCGAGGCGGCGTTCTTACCTG
CGATTCATGCTTCGCGAAATCAGTTGCATCTTCGTGGCCTGGTTTGTTCTCTATCTGATG
CTGGTATTGCGCGCCGTTGGCGCGGGCGGGAATTCCTACCAGCGGTTTTTGGACTTCAGC
GCCAATCCGGTTGTCGTAGTGCTGAACGTCGTCGCGTTGAGTTTCCTGCTGCTGCATGCT
GTTACCTGGTTCGGATCGGCACCGCGCGCGATGGTGATTCAGGTTCGCGGCCGCCGGGTA
CCCGCTCGCGCGGTCCTTGCTGGGCACTACGCGGCATGGCTGGTGGTTTCGGTGATCGTT
GCCTGGATGGTGCTGTCATGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Signaling Rv1571	active	razeeth.new	2012-10-05
	Co-expression AH. Li, WL. Lam et al. Bacterial artificial chromosome fingerprint arrays for the differentiation of transcriptomic differences in mycobacteria. J. Microbiol. Methods 2008
Interaction	Signaling Rv1571	active	razeeth.new	2012-10-05
	Co-expression AH. Li, WL. Lam et al. Characterization of genes differentially expressed within macrophages by virulent and attenuated Mycobacterium tuberculosis identifies candidate genes involved in intracellular growth. Microbiology (Reading, Engl.) 2008
Interaction	PhysicalInteraction Rv1553	active	vijayachitra	2012-10-05
	qPCR AH. Li, WL. Lam et al. Characterization of genes differentially expressed within macrophages by virulent and attenuated Mycobacterium tuberculosis identifies candidate genes involved in intracellular growth. Microbiology (Reading, Engl.) 2008
Interaction	PhysicalInteraction Rv1554	active	vijayachitra	2012-10-05
	qPCR AH. Li, WL. Lam et al. Characterization of genes differentially expressed within macrophages by virulent and attenuated Mycobacterium tuberculosis identifies candidate genes involved in intracellular growth. Microbiology (Reading, Engl.) 2008
Interaction	PhysicalInteraction Rv1554	active	vijayachitra	2012-10-05
	qPCR AH. Li, WL. Lam et al. Characterization of genes differentially expressed within macrophages by virulent and attenuated Mycobacterium tuberculosis identifies candidate genes involved in intracellular growth. Microbiology (Reading, Engl.) 2008
Interaction	PhysicalInteraction Rv1552	active	vijayachitra	2012-10-05
	qPCR AH. Li, WL. Lam et al. Characterization of genes differentially expressed within macrophages by virulent and attenuated Mycobacterium tuberculosis identifies candidate genes involved in intracellular growth. Microbiology (Reading, Engl.) 2008
Interaction	PhysicalInteraction Rv1553	active	ashwinigbhat	2012-10-05
	qPCR AH. Li, WL. Lam et al. Characterization of genes differentially expressed within macrophages by virulent and attenuated Mycobacterium tuberculosis identifies candidate genes involved in intracellular growth. Microbiology (Reading, Engl.) 2008
Interaction	PhysicalInteraction Rv1552	active	ashwinigbhat	2012-10-05
	qPCR AH. Li, WL. Lam et al. Characterization of genes differentially expressed within macrophages by virulent and attenuated Mycobacterium tuberculosis identifies candidate genes involved in intracellular growth. Microbiology (Reading, Engl.) 2008
Term	EC:1.3.99.1 Succinate dehydrogenase. - NR	active	extern:JZUCKER	2012-03-06
	Traceable author statement to experimental support authors,KY. Rhee,LP. de Carvalho,R. Bryk,S. Ehrt,J. Marrero,SW. Park,D. Schnappinger,A. Venugopal,C. Nathan Central carbon metabolism in Mycobacterium tuberculosis: an unexpected frontier. Trends Microbiol. 2011