Rv1560 - conserved hypothetical protein

Expression: Most Significant Conditions for Rv1560

Protein Domains

Gene Information
Locus	Rv1560
Symbol
Gene Name	conserved hypothetical protein
Location	1764755 - 1764973 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:219 bp Protein:73 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	9794
Related Genes	MT1611
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv1560
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv1560 Transcript 1
MYRWCMSRTNIDIDDELAAEVMRRFGLTTKRAAVDLALRRLVGSPLSREFLLGLEGVGWE
GDLDDLRSDRPD*

Genomic Sequence

>Rv1560
GTGTATCGTTGGTGTATGTCGCGCACCAACATCGACATCGATGACGAACTTGCCGCCGAG
GTCATGCGCAGGTTCGGTCTGACCACCAAGAGGGCGGCGGTCGACCTTGCCCTACGACGG
TTGGTCGGGTCGCCGTTGAGCCGTGAGTTTCTGCTCGGGCTGGAAGGCGTCGGCTGGGAA
GGCGACCTGGATGACTTGCGAAGCGATCGCCCAGACTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	InhibitedBy Rv1561	active	vizhi.gurusamy	2012-10-05
	Functional linkage (Gene neighborhood) authors,HR. Ramage,LE. Connolly,JS. Cox Comprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. PLoS Genet. 2009
Interaction	InhibitedBy Rv1561	active	vizhi.gurusamy	2012-10-05
	Functional linkage (Gene neighborhood) authors,A. Gupta Killing activity and rescue function of genome-wide toxin-antitoxin loci of Mycobacterium tuberculosis. FEMS Microbiol. Lett. 2009
Interaction	Inhibits Rv1561	active	vizhi.gurusamy	2012-10-05
	Functional linkage (Gene neighborhood) authors,A. Gupta Killing activity and rescue function of genome-wide toxin-antitoxin loci of Mycobacterium tuberculosis. FEMS Microbiol. Lett. 2009
Symbol	VapB11	active	jlew	2012-03-07
	Relieves toxin activity. We report the heterologous toxicity of these TA loci in Escherichia coli and show that only a few of the M. tuberculosis-encoded toxins can inhibit E. coli growth and have a killing effect. This killing effect can be suppressed by coexpression of the cognate antitoxin. authors,A. Gupta Killing activity and rescue function of genome-wide toxin-antitoxin loci of Mycobacterium tuberculosis. FEMS Microbiol. Lett. 2009
Other	strand:+	active	rslayden	2012-03-05
	MTCY270.36C (76 aa); etc.
Other	stop:1764973	active	rslayden	2012-03-05
	MTCY270.36C (76 aa); etc.
Other	start:1764755	active	rslayden	2012-03-05
	MTCY270.36C (76 aa); etc.
Symbol	Vap BC-11	active	rslayden	2012-03-05
	MTCY270.36C (76 aa); etc.
Other	strand:+	active	rslayden	2012-03-05
	Rv2132
Other	stop:1764973	active	rslayden	2012-03-05
	Rv2132
Other	start:1764755	active	rslayden	2012-03-05
	Rv2132
Symbol	Vap BC-11	active	rslayden	2012-03-05
	Rv2132
Other	strand:+	active	rslayden	2012-03-05
	MTV006.13 (86 aa), O06243
Other	stop:1764973	active	rslayden	2012-03-05
	MTV006.13 (86 aa), O06243
Other	start:1764755	active	rslayden	2012-03-05
	MTV006.13 (86 aa), O06243
Symbol	Vap BC-11	active	rslayden	2012-03-05
	MTV006.13 (86 aa), O06243
Other	strand:+	active	rslayden	2012-03-05
	Rv1241
Other	stop:1764973	active	rslayden	2012-03-05
	Rv1241
Other	start:1764755	active	rslayden	2012-03-05
	Rv1241
Symbol	Vap BC-11	active	rslayden	2012-03-05
	Rv1241
Other	strand:+	active	rslayden	2012-03-05
	MTCY274.02 (85 aa); O50456
Other	stop:1764973	active	rslayden	2012-03-05
	MTCY274.02 (85 aa); O50456
Other	start:1764755	active	rslayden	2012-03-05
	MTCY274.02 (85 aa); O50456
Symbol	Vap BC-11	active	rslayden	2012-03-05
	MTCY274.02 (85 aa); O50456
Other	strand:+	active	rslayden	2012-03-05
	Rv2871
Other	stop:1764973	active	rslayden	2012-03-05
	Rv2871
Other	start:1764755	active	rslayden	2012-03-05
	Rv2871
Symbol	Vap BC-11	active	rslayden	2012-03-05
	Rv2871
Other	strand:+	active	rslayden	2012-03-05
	MTCY39.08c (80 aa), FASTA score: (54.4% identity in 68 aa overlap); Q10799
Other	stop:1764973	active	rslayden	2012-03-05
	MTCY39.08c (80 aa), FASTA score: (54.4% identity in 68 aa overlap); Q10799
Other	start:1764755	active	rslayden	2012-03-05
	MTCY39.08c (80 aa), FASTA score: (54.4% identity in 68 aa overlap); Q10799
Symbol	Vap BC-11	active	rslayden	2012-03-05
	MTCY39.08c (80 aa), FASTA score: (54.4% identity in 68 aa overlap); Q10799
Other	strand:+	active	rslayden	2012-03-05
	Rv2009
Other	stop:1764973	active	rslayden	2012-03-05
	Rv2009
Other	start:1764755	active	rslayden	2012-03-05
	Rv2009
Symbol	Vap BC-11	active	rslayden	2012-03-05
	Rv2009
Other	strand:+	active	rslayden	2012-03-05
	Conserved hypothetical protein, part of a Mycobacterial tuberculosis family of proteins e.g. Q10848
Other	stop:1764973	active	rslayden	2012-03-05
	Conserved hypothetical protein, part of a Mycobacterial tuberculosis family of proteins e.g. Q10848
Other	start:1764755	active	rslayden	2012-03-05
	Conserved hypothetical protein, part of a Mycobacterial tuberculosis family of proteins e.g. Q10848
Symbol	Vap BC-11	active	rslayden	2012-03-05
	Conserved hypothetical protein, part of a Mycobacterial tuberculosis family of proteins e.g. Q10848