Rv1581c - phiRv1 phage protein

Expression: Most Significant Conditions for Rv1581c

Protein Domains

Gene Information
Locus	Rv1581c
Symbol
Gene Name	phiRv1 phage protein
Location	1783906 - 1784301 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:396 bp Protein:132 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	8998
Related Genes
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv1581c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv1581c Transcript 1
MTAVAITPASGGRHSVRFAYDSAIVSLIKSTIPAYARSWSAHTRCWFIDADWTPLLAAEL
RYHGHTVTGPADPAQQQCTDWAKALFRAVGPQRTPAVYRALSKVLHPDAPTGCPILQQQL
NAARTALTNPA*

Genomic Sequence

>Rv1581c
ATGACCGCTGTCGCGATCACCCCGGCATCCGGCGGTCGGCACAGCGTCCGATTCGCCTAC
GACTCTGCGATCGTGTCGTTGATCAAGTCCACGATCCCCGCCTATGCCCGCTCCTGGTCC
GCGCACACCCGCTGCTGGTTCATCGACGCTGACTGGACCCCACTGCTGGCCGCCGAGCTG
CGCTACCACGGCCACACCGTCACCGGACCCGCCGACCCGGCGCAACAGCAGTGCACCGAC
TGGGCCAAAGCGTTGTTCCGGGCGGTCGGACCCCAGCGGACACCCGCCGTGTACAGGGCT
TTATCCAAAGTGCTGCACCCCGACGCCCCAACCGGATGCCCGATACTGCAACAGCAGCTC
AATGCCGCCAGAACCGCACTTACCAACCCTGCTTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Transcription Rv3676	active	jgalag	2012-10-05
	Band shift M. Stapleton, I. Haq et al. Mycobacterium tuberculosis cAMP receptor protein (Rv3676) differs from the Escherichia coli paradigm in its cAMP binding and DNA binding properties and transcription activation properties. J. Biol. Chem. 2010
Interaction	Transcription Rv3676	active	jgalag	2012-10-05
	Band shift M. Stapleton, I. Haq et al. Mycobacterium tuberculosis cAMP receptor protein (Rv3676) differs from the Escherichia coli paradigm in its cAMP binding and DNA binding properties and transcription activation properties. J. Biol. Chem. 2010
Interaction	Transcription Rv3676	active	jgalag	2012-10-05
	Band shift G. Bai, LA. McCue et al. Characterization of Mycobacterium tuberculosis Rv3676 (CRPMt), a cyclic AMP receptor protein-like DNA binding protein. J. Bacteriol. 2005
Interaction	Transcription Rv3676	active	jgalag	2012-10-05
	Band shift G. Bai, LA. McCue et al. Characterization of Mycobacterium tuberculosis Rv3676 (CRPMt), a cyclic AMP receptor protein-like DNA binding protein. J. Bacteriol. 2005
Interaction	RegulatedBy Rv3676	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008