Rv1621c - transmembrane ATP-binding protein ABC transporter cydD

Expression: Most Significant Conditions for Rv1621c

Protein Domains

Gene Information
Locus	Rv1621c
Symbol	cydD
Gene Name	transmembrane ATP-binding protein ABC transporter cydD
Location	1821690 - 1823273 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:1584 bp Protein:528 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	36435
Related Genes	MAP1314c MAV_3166 Mkms_3097 Mmcs_3038 MSMEG_3231 MT1657 MUL_1602 Mvan_2828 nfa5870
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv1621c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv1621c Transcript 1
MACGVGISGCAIGSAIVLASIVAGVIDPANPGMAGLRRWLGPLSILLVLWGLRASIQWLQ
ARLAQRGASAVIADLSGQVLTAVTARRPSQLAAQRDAAAVLITRGLDGLRPYFTGYLPTL
LLAAILTPATVAVIGLYDLKSMAIVVITLPLIPIFMVLIGLATTNPSAAALAAMTAVQAR
LLDLIAGIPTLRALGRASGPEQRIAELSADHRRSAMATLRIAFLSALVLELLATLGVALV
AVGIGLRLVFGEMSLTAGLTVLLLAPEVYWPLRRVGVQFHAAADGRTAADKAFALLGESP
SPTPGRRTVTARGGVIRLERLSVRGRDGRAPYDLTADIEPGRVTVLTGRNGAGKSTTLQA
IAGLTAPSSGRITVAGVDVTNLAPAAWWRQLSWLPQRPVLVPGTVRHNLVLLGPVDDLER
ACAAAGFDAVLDELPRGLDTVLGRGGVGLSLGQRQRLGLARALGSPAAVLLLDEPTAHLD
ARTEQHVLGAIVERARAGATVLVVAHRQQVAAAGDRVVEVNSDGFRR*

Genomic Sequence

>Rv1621c
GTGGCCTGCGGGGTCGGGATCTCCGGCTGCGCCATCGGCTCGGCGATCGTGTTGGCAAGC
ATCGTCGCCGGCGTCATCGACCCCGCCAACCCTGGGATGGCTGGCCTGCGTCGTTGGCTA
GGGCCACTGTCAATCCTGTTGGTGCTGTGGGGGTTGCGTGCGTCGATTCAGTGGCTACAA
GCGCGCCTGGCCCAGCGCGGCGCCAGCGCAGTGATCGCCGACCTGTCCGGTCAGGTGCTG
ACCGCGGTAACCGCCCGCCGACCCAGCCAACTGGCTGCGCAGCGAGACGCCGCCGCGGTG
CTGATTACCCGGGGCCTGGACGGCTTGCGGCCCTACTTCACCGGCTATTTGCCCACGTTG
CTGCTGGCCGCGATCCTGACCCCGGCCACCGTCGCCGTGATCGGGCTCTATGACTTGAAG
TCAATGGCCATTGTGGTGATCACACTGCCCCTGATACCGATCTTCATGGTGCTGATCGGG
CTGGCTACCACTAACCCCTCGGCGGCCGCGCTGGCGGCCATGACCGCCGTCCAGGCCCGG
TTGTTAGACCTGATTGCCGGCATCCCCACCCTGCGGGCGCTGGGCCGTGCTTCCGGCCCG
GAACAACGCATCGCGGAACTGTCTGCTGACCACCGGCGGTCGGCGATGGCGACGCTGCGG
ATCGCGTTCTTGTCGGCCCTGGTGCTCGAATTGCTGGCCACGCTGGGCGTGGCCCTGGTC
GCGGTGGGCATCGGGCTACGGCTGGTCTTCGGGGAGATGAGCCTGACGGCCGGTTTGACG
GTGCTGCTATTGGCGCCGGAGGTGTACTGGCCGCTGCGTCGCGTTGGGGTCCAGTTTCAT
GCCGCAGCTGACGGCAGAACCGCGGCCGACAAGGCATTCGCCCTCCTCGGCGAGTCACCC
TCACCAACACCCGGCCGACGAACGGTCACCGCGCGCGGCGGGGTGATTCGCCTGGAGAGA
CTCAGTGTCAGAGGCCGCGACGGCCGCGCACCGTATGATCTCACCGCAGACATCGAACCC
GGTCGGGTGACGGTGCTGACCGGCCGAAACGGCGCCGGCAAGAGCACTACGCTGCAAGCG
ATCGCCGGGCTCACCGCACCGTCGTCAGGACGAATCACGGTCGCCGGAGTCGACGTCACC
AACCTGGCACCGGCTGCCTGGTGGCGGCAACTGTCGTGGCTGCCGCAGCGGCCGGTGCTG
GTCCCAGGAACCGTCCGCCACAACCTGGTTCTGCTGGGCCCTGTGGATGATCTCGAGCGT
GCCTGCGCAGCAGCCGGATTCGACGCTGTACTAGACGAGTTGCCCCGCGGGCTGGATACC
GTGCTGGGGCGCGGTGGTGTCGGGTTATCCCTGGGGCAGCGGCAACGGCTGGGCCTGGCC
CGCGCGCTCGGATCACCGGCTGCGGTGCTGCTGCTCGACGAGCCCACCGCGCACCTGGAC
GCCCGCACCGAACAACACGTGTTGGGCGCCATTGTCGAGCGTGCCCGCGCGGGTGCGACG
GTGCTGGTCGTCGCCCATCGCCAGCAGGTCGCCGCGGCCGGTGACCGGGTCGTCGAAGTG
AACTCGGATGGTTTCCGACGATGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Operon Rv1623c	active	ashwinigbhat	2012-10-05
	BD. Kana, EA. Weinstein et al. Characterization of the cydAB-encoded cytochrome bd oxidase from Mycobacterium smegmatis. J. Bacteriol. 2001
Interaction	Operon Rv1623c	active	ashwinigbhat	2012-10-05
	authors,H. Cruz-Ramos,GM. Cook,G. Wu,MW. Cleeter,RK. Poole Membrane topology and mutational analysis of Escherichia coli CydDC, an ABC-type cysteine exporter required for cytochrome assembly. Microbiology (Reading, Engl.) 2004
Interaction	Operon Rv1623c	active	priti.priety	2012-10-05
	BD. Kana, EA. Weinstein et al. Characterization of the cydAB-encoded cytochrome bd oxidase from Mycobacterium smegmatis. J. Bacteriol. 2001
Interaction	Operon Rv1623c	active	priti.priety	2012-10-05
	authors,H. Cruz-Ramos,GM. Cook,G. Wu,MW. Cleeter,RK. Poole Membrane topology and mutational analysis of Escherichia coli CydDC, an ABC-type cysteine exporter required for cytochrome assembly. Microbiology (Reading, Engl.) 2004
Interaction	Operon Rv1622c	active	ashwinigbhat	2012-10-05
	BD. Kana, EA. Weinstein et al. Characterization of the cydAB-encoded cytochrome bd oxidase from Mycobacterium smegmatis. J. Bacteriol. 2001
Interaction	Operon Rv1622c	active	ashwinigbhat	2012-10-05
	authors,H. Cruz-Ramos,GM. Cook,G. Wu,MW. Cleeter,RK. Poole Membrane topology and mutational analysis of Escherichia coli CydDC, an ABC-type cysteine exporter required for cytochrome assembly. Microbiology (Reading, Engl.) 2004
Interaction	Operon Rv1622c	active	priti.priety	2012-10-05
	BD. Kana, EA. Weinstein et al. Characterization of the cydAB-encoded cytochrome bd oxidase from Mycobacterium smegmatis. J. Bacteriol. 2001
Interaction	Operon Rv1622c	active	priti.priety	2012-10-05
	authors,H. Cruz-Ramos,GM. Cook,G. Wu,MW. Cleeter,RK. Poole Membrane topology and mutational analysis of Escherichia coli CydDC, an ABC-type cysteine exporter required for cytochrome assembly. Microbiology (Reading, Engl.) 2004
Interaction	Operon Rv1622c	active	ashwinigbhat	2012-10-05
	BD. Kana, EA. Weinstein et al. Characterization of the cydAB-encoded cytochrome bd oxidase from Mycobacterium smegmatis. J. Bacteriol. 2001
Interaction	Operon Rv1623c	active	ashwinigbhat	2012-10-05
	BD. Kana, EA. Weinstein et al. Characterization of the cydAB-encoded cytochrome bd oxidase from Mycobacterium smegmatis. J. Bacteriol. 2001
Interaction	Operon Rv1620c	active	ashwinigbhat	2012-10-05
	BD. Kana, EA. Weinstein et al. Characterization of the cydAB-encoded cytochrome bd oxidase from Mycobacterium smegmatis. J. Bacteriol. 2001
Interaction	Operon Rv1622c	active	ashwinigbhat	2012-10-05
	authors,H. Cruz-Ramos,GM. Cook,G. Wu,MW. Cleeter,RK. Poole Membrane topology and mutational analysis of Escherichia coli CydDC, an ABC-type cysteine exporter required for cytochrome assembly. Microbiology (Reading, Engl.) 2004
Interaction	Operon Rv1623c	active	ashwinigbhat	2012-10-05
	authors,H. Cruz-Ramos,GM. Cook,G. Wu,MW. Cleeter,RK. Poole Membrane topology and mutational analysis of Escherichia coli CydDC, an ABC-type cysteine exporter required for cytochrome assembly. Microbiology (Reading, Engl.) 2004
Interaction	Operon Rv1620c	active	ashwinigbhat	2012-10-05
	authors,H. Cruz-Ramos,GM. Cook,G. Wu,MW. Cleeter,RK. Poole Membrane topology and mutational analysis of Escherichia coli CydDC, an ABC-type cysteine exporter required for cytochrome assembly. Microbiology (Reading, Engl.) 2004
Interaction	Operon Rv1622c	active	priti.priety	2012-10-05
	BD. Kana, EA. Weinstein et al. Characterization of the cydAB-encoded cytochrome bd oxidase from Mycobacterium smegmatis. J. Bacteriol. 2001
Interaction	Operon Rv1623c	active	priti.priety	2012-10-05
	BD. Kana, EA. Weinstein et al. Characterization of the cydAB-encoded cytochrome bd oxidase from Mycobacterium smegmatis. J. Bacteriol. 2001
Interaction	Operon Rv1620c	active	priti.priety	2012-10-05
	BD. Kana, EA. Weinstein et al. Characterization of the cydAB-encoded cytochrome bd oxidase from Mycobacterium smegmatis. J. Bacteriol. 2001
Interaction	Operon Rv1622c	active	priti.priety	2012-10-05
	authors,H. Cruz-Ramos,GM. Cook,G. Wu,MW. Cleeter,RK. Poole Membrane topology and mutational analysis of Escherichia coli CydDC, an ABC-type cysteine exporter required for cytochrome assembly. Microbiology (Reading, Engl.) 2004
Interaction	Operon Rv1623c	active	priti.priety	2012-10-05
	authors,H. Cruz-Ramos,GM. Cook,G. Wu,MW. Cleeter,RK. Poole Membrane topology and mutational analysis of Escherichia coli CydDC, an ABC-type cysteine exporter required for cytochrome assembly. Microbiology (Reading, Engl.) 2004
Interaction	Operon Rv1620c	active	priti.priety	2012-10-05
	authors,H. Cruz-Ramos,GM. Cook,G. Wu,MW. Cleeter,RK. Poole Membrane topology and mutational analysis of Escherichia coli CydDC, an ABC-type cysteine exporter required for cytochrome assembly. Microbiology (Reading, Engl.) 2004
Interaction	Operon Rv1620c	active	ashwinigbhat	2012-10-05
	BD. Kana, EA. Weinstein et al. Characterization of the cydAB-encoded cytochrome bd oxidase from Mycobacterium smegmatis. J. Bacteriol. 2001
Interaction	Operon Rv1620c	active	ashwinigbhat	2012-10-05
	authors,H. Cruz-Ramos,GM. Cook,G. Wu,MW. Cleeter,RK. Poole Membrane topology and mutational analysis of Escherichia coli CydDC, an ABC-type cysteine exporter required for cytochrome assembly. Microbiology (Reading, Engl.) 2004
Interaction	Operon Rv1620c	active	priti.priety	2012-10-05
	BD. Kana, EA. Weinstein et al. Characterization of the cydAB-encoded cytochrome bd oxidase from Mycobacterium smegmatis. J. Bacteriol. 2001
Interaction	Operon Rv1620c	active	priti.priety	2012-10-05
	authors,H. Cruz-Ramos,GM. Cook,G. Wu,MW. Cleeter,RK. Poole Membrane topology and mutational analysis of Escherichia coli CydDC, an ABC-type cysteine exporter required for cytochrome assembly. Microbiology (Reading, Engl.) 2004