Rv1642 - 50S ribosomal protein L35 rpmI

Expression: Most Significant Conditions for Rv1642

Protein Domains

Gene Information
Locus	Rv1642
Symbol	rpmI
Gene Name	50S ribosomal protein L35 rpmI
Location	1852928 - 1853122 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:195 bp Protein:65 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	607
Related Genes	Acel_1268 BL1366a CE1510 cg1564 DIP1161 jk0835 MAP1353 MAV_3126 Mkms_3024 ML1395 Mmcs_2980 MSMEG_3792 MT1680 MUL_1628 Mvan_3327 nfa19150 PPA1413 SAV6738 SCO1599
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv1642
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv1642 Transcript 1
MPKAKTHSGASKRFRRTGTGKIVRQKANRRHLLEHKPSTRTRRLDGRTVVAANDTKRVTS
LLNG*

Genomic Sequence

>Rv1642
ATGCCCAAGGCCAAGACCCACAGCGGGGCCTCGAAGCGGTTCCGGCGCACCGGTACCGGC
AAGATCGTCCGGCAGAAGGCCAACCGTCGGCACCTGCTCGAGCACAAGCCGAGCACCCGC
ACCAGGCGCCTGGACGGCCGCACCGTGGTGGCAGCCAACGACACCAAACGGGTCACGTCG
TTGCTGAACGGCTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Transcription Rv1643	active	sourish10	2012-10-05
	Co-expression (Functional linkage) authors,RJ. Smith,RG. Bryant Metal substitutions incarbonic anhydrase: a halide ion probe study. Biochem. Biophys. Res. Commun. 1975
Interaction	Transcription Rv1643	active	sourish10	2012-10-05
	Co-expression (Functional linkage) authors,YW. Chow,R. Pietranico,A. Mukerji Studies of oxygen binding energy to hemoglobin molecule. Biochem. Biophys. Res. Commun. 1975
Interaction	Transcription Rv1643	active	sourish10	2012-10-05
	Co-expression (Functional linkage) authors,RJ. Smith,RG. Bryant Metal substitutions incarbonic anhydrase: a halide ion probe study. Biochem. Biophys. Res. Commun. 1975
Interaction	Transcription Rv1643	active	sourish10	2012-10-05
	Co-expression (Functional linkage) authors,N. Choonee,S. Even,L. Zig,H. Putzer Ribosomal protein L20 controls expression of the Bacillus subtilis infC operon via a transcription attenuation mechanism. Nucleic Acids Res. 2007
Interaction	Transcription Rv1643	active	sourish10	2012-10-05
	Co-expression (Functional linkage) authors,F. Allemand,J. Haentjens,C. Chiaruttini,C. Royer,M. Springer Escherichia coli ribosomal protein L20 binds as a single monomer to its own mRNA bearing two potential binding sites. Nucleic Acids Res. 2007
Interaction	Transcription Rv1643	active	sourish10	2012-10-05
	Affinity purification (Physical interaction) authors,RJ. Smith,RG. Bryant Metal substitutions incarbonic anhydrase: a halide ion probe study. Biochem. Biophys. Res. Commun. 1975
Interaction	Transcription Rv1643	active	sourish10	2012-10-05
	Affinity purification (Physical interaction) authors,YW. Chow,R. Pietranico,A. Mukerji Studies of oxygen binding energy to hemoglobin molecule. Biochem. Biophys. Res. Commun. 1975
Interaction	Transcription Rv1643	active	sourish10	2012-10-05
	Affinity purification (Physical interaction) authors,RJ. Smith,RG. Bryant Metal substitutions incarbonic anhydrase: a halide ion probe study. Biochem. Biophys. Res. Commun. 1975
Interaction	Transcription Rv1643	active	sourish10	2012-10-05
	Affinity purification (Physical interaction) authors,N. Choonee,S. Even,L. Zig,H. Putzer Ribosomal protein L20 controls expression of the Bacillus subtilis infC operon via a transcription attenuation mechanism. Nucleic Acids Res. 2007
Interaction	Transcription Rv1643	active	sourish10	2012-10-05
	Affinity purification (Physical interaction) authors,F. Allemand,J. Haentjens,C. Chiaruttini,C. Royer,M. Springer Escherichia coli ribosomal protein L20 binds as a single monomer to its own mRNA bearing two potential binding sites. Nucleic Acids Res. 2007
Interaction	Transcription Rv1643	active	sourish10	2012-10-05
	Co-expression (Functional linkage) authors,RJ. Smith,RG. Bryant Metal substitutions incarbonic anhydrase: a halide ion probe study. Biochem. Biophys. Res. Commun. 1975
Interaction	Transcription Rv1643	active	sourish10	2012-10-05
	Co-expression (Functional linkage) authors,YW. Chow,R. Pietranico,A. Mukerji Studies of oxygen binding energy to hemoglobin molecule. Biochem. Biophys. Res. Commun. 1975
Interaction	Transcription Rv1643	active	sourish10	2012-10-05
	Co-expression (Functional linkage) authors,RJ. Smith,RG. Bryant Metal substitutions incarbonic anhydrase: a halide ion probe study. Biochem. Biophys. Res. Commun. 1975
Interaction	Transcription Rv1643	active	sourish10	2012-10-05
	Co-expression (Functional linkage) authors,N. Choonee,S. Even,L. Zig,H. Putzer Ribosomal protein L20 controls expression of the Bacillus subtilis infC operon via a transcription attenuation mechanism. Nucleic Acids Res. 2007
Interaction	Transcription Rv1643	active	sourish10	2012-10-05
	Co-expression (Functional linkage) authors,F. Allemand,J. Haentjens,C. Chiaruttini,C. Royer,M. Springer Escherichia coli ribosomal protein L20 binds as a single monomer to its own mRNA bearing two potential binding sites. Nucleic Acids Res. 2007
Interaction	Transcription Rv1643	active	sourish10	2012-10-05
	Affinity purification (Physical interaction) authors,RJ. Smith,RG. Bryant Metal substitutions incarbonic anhydrase: a halide ion probe study. Biochem. Biophys. Res. Commun. 1975
Interaction	Transcription Rv1643	active	sourish10	2012-10-05
	Affinity purification (Physical interaction) authors,YW. Chow,R. Pietranico,A. Mukerji Studies of oxygen binding energy to hemoglobin molecule. Biochem. Biophys. Res. Commun. 1975
Interaction	Transcription Rv1643	active	sourish10	2012-10-05
	Affinity purification (Physical interaction) authors,RJ. Smith,RG. Bryant Metal substitutions incarbonic anhydrase: a halide ion probe study. Biochem. Biophys. Res. Commun. 1975
Interaction	Transcription Rv1643	active	sourish10	2012-10-05
	Affinity purification (Physical interaction) authors,N. Choonee,S. Even,L. Zig,H. Putzer Ribosomal protein L20 controls expression of the Bacillus subtilis infC operon via a transcription attenuation mechanism. Nucleic Acids Res. 2007
Interaction	Transcription Rv1643	active	sourish10	2012-10-05
	Affinity purification (Physical interaction) authors,F. Allemand,J. Haentjens,C. Chiaruttini,C. Royer,M. Springer Escherichia coli ribosomal protein L20 binds as a single monomer to its own mRNA bearing two potential binding sites. Nucleic Acids Res. 2007