Rv1785c - cytochrome P450 143 cyp143

Expression: Most Significant Conditions for Rv1785c

Protein Domains

Gene Information
Locus	Rv1785c
Symbol	cyp143
Gene Name	cytochrome P450 143 cyp143
Location	2023447 - 2024628 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:1182 bp Protein:394 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	26363
Related Genes	Acel_1038 MAP1503c MAV_2548 MAV_2931 MT1834 MUL_3091 MUL_3106 nfa22920 nfa22930 nfa4950 SAV109
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv1785c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv1785c Transcript 1
MTTPGEDHAGSFYLPRLEYSTLPMAVDRGVGWKTLRDAGPVVFMNGWYYLTRREDVLAAL
RNPKVFSSRKALQPPGNPLPVVPLAFDPPEHTRYRRILQPYFSPAALSKALPSLRRHTVA
MIDAIAGRGECEAMADLANLFPFQLFLVLYGLPLEDRDRLIGWKDAVIAMSDRPHPTEAD
VAAARELLEYLTAMVAERRRNPGPDVLSQVQIGEDPLSEIEVLGLSHLLILAGLDTVTAA
VGFSLLELARRPQLRAMLRDNPKQIRVFIEEIVRLEPSAPVAPRVTTEPVTVGGMTLPAG
SPVRLCMAAVNRDGSDAMSTDELVMDGKVHRHWGFGGGPHRCLGSHLARLELTLLVGEWL
NQIPDFELAPDYAPEIRFPSKSFALKNLPLRWS*

Genomic Sequence

>Rv1785c
ATGACCACCCCCGGCGAGGACCACGCCGGCTCGTTTTATCTACCGCGGCTCGAATATTCG
ACGTTACCGATGGCCGTTGACCGGGGTGTCGGCTGGAAGACCCTCCGCGACGCGGGGCCC
GTGGTGTTCATGAACGGCTGGTACTACCTGACGCGCCGCGAAGATGTGCTCGCGGCGCTG
CGGAATCCGAAGGTTTTCTCGTCGCGGAAAGCGCTGCAACCTCCGGGAAATCCGCTGCCG
GTGGTTCCGCTCGCGTTCGACCCGCCCGAGCACACCCGATACCGCAGGATCCTGCAGCCA
TACTTCAGCCCGGCCGCTTTGAGCAAGGCGCTACCGTCGCTGCGCCGTCACACTGTCGCT
ATGATCGACGCCATCGCAGGCCGGGGCGAGTGCGAGGCGATGGCCGATCTCGCGAATCTG
TTTCCGTTTCAGTTGTTTCTCGTCCTGTACGGCCTGCCGCTCGAAGACCGTGACCGTCTG
ATCGGCTGGAAAGACGCCGTCATCGCCATGTCGGATCGACCTCACCCGACCGAAGCCGAT
GTCGCTGCGGCGCGCGAGCTGCTCGAGTATCTCACGGCCATGGTCGCCGAACGCCGGCGA
AACCCAGGGCCGGACGTCTTGTCGCAAGTGCAGATCGGCGAGGACCCGTTGAGCGAGATC
GAGGTTTTGGGTTTGAGCCACCTCCTGATACTGGCGGGACTGGACACCGTGACGGCAGCG
GTAGGCTTTTCGCTGCTCGAGCTCGCCCGCAGACCACAGCTGCGCGCCATGCTGCGCGAC
AATCCCAAGCAGATCAGGGTTTTCATCGAAGAGATCGTCCGGCTGGAGCCATCGGCGCCG
GTGGCGCCGCGAGTTACCACCGAGCCCGTCACCGTCGGCGGCATGACACTGCCTGCGGGG
TCACCAGTGCGGTTATGCATGGCCGCAGTCAACCGCGACGGCAGCGACGCGATGTCCACC
GACGAGTTGGTGATGGATGGAAAGGTGCACCGGCACTGGGGATTTGGCGGCGGTCCACAC
CGTTGCCTGGGTTCGCATCTAGCCCGTTTAGAGCTCACCCTGCTGGTGGGCGAGTGGCTG
AATCAAATTCCCGACTTCGAGCTCGCGCCGGACTACGCGCCCGAAATACGGTTCCCGTCC
AAGTCCTTCGCGCTTAAGAACTTGCCGCTACGCTGGAGCTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Activation Rv1786	active	akankshajain.21	2012-10-05
	Gene Neighborhood (Functional linkage) KJ. McLean, AJ. Dunford et al. CYP121, CYP51 and associated redox systems in Mycobacterium tuberculosis: towards deconvoluting enzymology of P450 systems in a human pathogen. Biochem. Soc. Trans. 2006
Interaction	Activation Rv1786	active	saritatray	2012-10-05
	authors,H. Ouellet,JB. Johnston,PR. Ortiz de Montellano The Mycobacterium tuberculosis cytochrome P450 system. Arch. Biochem. Biophys. 2010
Interaction	Regulates Rv2995c	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv2847c	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv1617	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv1437	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv1436	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv1127c	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv0467	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv0253	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv0252	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv2995c	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. authors,M. Madan Babu,SA. Teichmann,L. Aravind Evolutionary dynamics of prokaryotic transcriptional regulatory networks. J. Mol. Biol. 2006
Interaction	Regulates Rv2847c	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. authors,M. Madan Babu,SA. Teichmann,L. Aravind Evolutionary dynamics of prokaryotic transcriptional regulatory networks. J. Mol. Biol. 2006
Interaction	Regulates Rv1617	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. authors,M. Madan Babu,SA. Teichmann,L. Aravind Evolutionary dynamics of prokaryotic transcriptional regulatory networks. J. Mol. Biol. 2006
Interaction	Regulates Rv1437	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. authors,M. Madan Babu,SA. Teichmann,L. Aravind Evolutionary dynamics of prokaryotic transcriptional regulatory networks. J. Mol. Biol. 2006
Interaction	Regulates Rv1436	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. authors,M. Madan Babu,SA. Teichmann,L. Aravind Evolutionary dynamics of prokaryotic transcriptional regulatory networks. J. Mol. Biol. 2006
Interaction	Regulates Rv1127c	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. authors,M. Madan Babu,SA. Teichmann,L. Aravind Evolutionary dynamics of prokaryotic transcriptional regulatory networks. J. Mol. Biol. 2006
Interaction	Regulates Rv0467	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. authors,M. Madan Babu,SA. Teichmann,L. Aravind Evolutionary dynamics of prokaryotic transcriptional regulatory networks. J. Mol. Biol. 2006
Interaction	Regulates Rv0253	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. authors,M. Madan Babu,SA. Teichmann,L. Aravind Evolutionary dynamics of prokaryotic transcriptional regulatory networks. J. Mol. Biol. 2006
Interaction	Regulates Rv0252	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. authors,M. Madan Babu,SA. Teichmann,L. Aravind Evolutionary dynamics of prokaryotic transcriptional regulatory networks. J. Mol. Biol. 2006