Rv1824 - conserved membrane protein

Expression: Most Significant Conditions for Rv1824

Protein Domains

Gene Information
Locus	Rv1824
Symbol
Gene Name	conserved membrane protein
Location	2070654 - 2071019 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:366 bp Protein:122 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	2753
Related Genes	Acel_1229 BL0748a MAP1537 MAV_2891 Mkms_2891 Mmcs_2847 MSMEG_3650 MT1872 MUL_3043 Mvan_3138 PPA1081 SAV6979
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv1824
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv1824 Transcript 1
MGSDTAWSPARMIGIAALAVGIVLGLVFHPGVPEVIQPYLPIAVVAALDAVFGGLRAYLE
RIFDPKVFVVSFVFNVLVAALIVYVGDQLGVGTQLSTAIIVVLGIRIFGNTAALRRRLFG
A*

Genomic Sequence

>Rv1824
ATGGGGAGCGATACGGCCTGGAGTCCGGCGCGCATGATCGGGATCGCGGCGCTCGCCGTT
GGAATCGTGCTGGGTTTGGTTTTCCATCCCGGCGTGCCAGAGGTCATCCAGCCGTATCTG
CCGATCGCGGTGGTCGCCGCGCTCGACGCGGTGTTCGGTGGCTTGCGCGCCTATCTCGAG
CGGATCTTTGACCCGAAGGTCTTCGTGGTTTCGTTCGTGTTCAACGTTTTGGTGGCTGCC
CTAATCGTCTATGTCGGTGACCAACTGGGCGTCGGCACACAGTTGTCCACCGCGATCATC
GTCGTGCTGGGCATCCGCATCTTCGGCAACACCGCGGCCTTGCGGCGGCGGTTGTTCGGA
GCGTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Transcription Rv1826	active	madhulsbu	2012-10-05
	Co-expression (Functional linkage) D. Homerova,K. Surdova,K. Mikusova,J. Kormanec Identification of promoters recognized by RNA polymerase containing Mycobacterium tuberculosis stress-response sigma factor sigma(F). Arch. Microbiol. 2007
Interaction	Transcription Rv1826	active	madhulsbu	2012-10-05
	Co-expression (Functional linkage) EP. Williams, JH. Lee et al. Mycobacterium tuberculosis SigF regulates genes encoding cell wall-associated proteins and directly regulates the transcriptional regulatory gene phoY1. J. Bacteriol. 2007
Interaction	Transcription Rv1825	active	sourish10	2012-10-05
	Co-expression (Functional linkage) D. Homerova,K. Surdova,K. Mikusova,J. Kormanec Identification of promoters recognized by RNA polymerase containing Mycobacterium tuberculosis stress-response sigma factor sigma(F). Arch. Microbiol. 2007
Interaction	Transcription Rv1825	active	sourish10	2012-10-05
	Co-expression (Functional linkage) EP. Williams, JH. Lee et al. Mycobacterium tuberculosis SigF regulates genes encoding cell wall-associated proteins and directly regulates the transcriptional regulatory gene phoY1. J. Bacteriol. 2007
Interaction	Transcription Rv1823	active	madhulsbu	2012-10-05
	Co-expression (Functional linkage) D. Homerova,K. Surdova,K. Mikusova,J. Kormanec Identification of promoters recognized by RNA polymerase containing Mycobacterium tuberculosis stress-response sigma factor sigma(F). Arch. Microbiol. 2007
Interaction	Transcription Rv1826	active	madhulsbu	2012-10-05
	Co-expression (Functional linkage) D. Homerova,K. Surdova,K. Mikusova,J. Kormanec Identification of promoters recognized by RNA polymerase containing Mycobacterium tuberculosis stress-response sigma factor sigma(F). Arch. Microbiol. 2007
Interaction	Transcription Rv1825	active	madhulsbu	2012-10-05
	Co-expression (Functional linkage) D. Homerova,K. Surdova,K. Mikusova,J. Kormanec Identification of promoters recognized by RNA polymerase containing Mycobacterium tuberculosis stress-response sigma factor sigma(F). Arch. Microbiol. 2007
Interaction	Transcription Rv1823	active	madhulsbu	2012-10-05
	Co-expression (Functional linkage) EP. Williams, JH. Lee et al. Mycobacterium tuberculosis SigF regulates genes encoding cell wall-associated proteins and directly regulates the transcriptional regulatory gene phoY1. J. Bacteriol. 2007
Interaction	Transcription Rv1826	active	madhulsbu	2012-10-05
	Co-expression (Functional linkage) EP. Williams, JH. Lee et al. Mycobacterium tuberculosis SigF regulates genes encoding cell wall-associated proteins and directly regulates the transcriptional regulatory gene phoY1. J. Bacteriol. 2007
Interaction	Transcription Rv1825	active	madhulsbu	2012-10-05
	Co-expression (Functional linkage) EP. Williams, JH. Lee et al. Mycobacterium tuberculosis SigF regulates genes encoding cell wall-associated proteins and directly regulates the transcriptional regulatory gene phoY1. J. Bacteriol. 2007
Interaction	Transcription Rv3286c	active	madhulsbu	2012-10-05
	Co-expression (Functional linkage) D. Homerova,K. Surdova,K. Mikusova,J. Kormanec Identification of promoters recognized by RNA polymerase containing Mycobacterium tuberculosis stress-response sigma factor sigma(F). Arch. Microbiol. 2007
Interaction	Transcription Rv3286c	active	madhulsbu	2012-10-05
	Co-expression (Functional linkage) EP. Williams, JH. Lee et al. Mycobacterium tuberculosis SigF regulates genes encoding cell wall-associated proteins and directly regulates the transcriptional regulatory gene phoY1. J. Bacteriol. 2007
Interaction	Transcription Rv1823	active	madhulsbu	2012-10-05
	Co-expression (Functional linkage) D. Homerova,K. Surdova,K. Mikusova,J. Kormanec Identification of promoters recognized by RNA polymerase containing Mycobacterium tuberculosis stress-response sigma factor sigma(F). Arch. Microbiol. 2007
Interaction	Transcription Rv1823	active	madhulsbu	2012-10-05
	Co-expression (Functional linkage) EP. Williams, JH. Lee et al. Mycobacterium tuberculosis SigF regulates genes encoding cell wall-associated proteins and directly regulates the transcriptional regulatory gene phoY1. J. Bacteriol. 2007
Interaction	RegulatedBy Rv3286c	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. EP. Williams, JH. Lee et al. Mycobacterium tuberculosis SigF regulates genes encoding cell wall-associated proteins and directly regulates the transcriptional regulatory gene phoY1. J. Bacteriol. 2007
Interaction	RegulatedBy Rv3286c	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. EP. Williams, JH. Lee et al. Mycobacterium tuberculosis SigF regulates genes encoding cell wall-associated proteins and directly regulates the transcriptional regulatory gene phoY1. J. Bacteriol. 2007