Rv1825 - conserved hypothetical protein

Expression: Most Significant Conditions for Rv1825

Protein Domains

Gene Information
Locus	Rv1825
Symbol
Gene Name	conserved hypothetical protein
Location	2071036 - 2071914 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:879 bp Protein:293 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	32659
Related Genes	Acel_1228 Acel_1230 BL0748 BL0749 MAP1536 MAP1538 MAV_2890 MAV_2892 Mkms_2890 Mkms_2892 Mmcs_2846 Mmcs_2848 MSMEG_3649 MSMEG_3651 MT1871 MT1873 MUL_3042 MUL_3044 Mvan_3137 Mvan_3139 PPA1080 PPA1082 Rv1823 SAV6978 SAV6980
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv1825
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv1825 Transcript 1
MSENRPEPVAAETSAATTARHSQADAGAHDAVRRGRHELPADHPRSKVGPLRRTRLTEIL
RGGRSRLVFGTLAILLCLVLGVAIVTQVRQTDSGDSLETARPADLLVLLDSLRQREATLN
AEVIDLQNTLNALQASGNTDQAALESAQARLAALSILVGAVGATGPGVMITIDDPGPGVA
PEVMIDVINELRAAGAEAIQINDAHRSVRVGVDTWVVGVPGSLTVDTKVLSPPYSILAIG
DPPTLAAAMNIPGGAQDGVKRVGGRMVVQQADRVDVTALRQPKQHQYAQPVK*

Genomic Sequence

>Rv1825
GTGAGTGAGAATCGCCCAGAACCCGTGGCAGCCGAGACTTCCGCCGCCACAACTGCGCGT
CACTCCCAAGCCGACGCGGGCGCTCACGACGCCGTGCGACGTGGTCGTCACGAACTACCA
GCCGACCATCCGCGCTCCAAGGTCGGACCGCTGCGGCGGACAAGATTGACCGAAATACTG
CGGGGTGGTCGCTCGCGTCTGGTGTTCGGGACGCTTGCGATCTTGTTGTGCTTGGTTCTG
GGGGTTGCCATAGTCACTCAGGTCCGTCAGACCGACTCCGGTGATTCATTGGAAACAGCC
CGTCCTGCAGACCTATTGGTGTTGTTGGATTCGTTGCGGCAACGCGAGGCCACGTTGAAC
GCCGAAGTGATCGACCTTCAGAACACGCTGAACGCGTTGCAGGCATCCGGCAACACCGAT
CAGGCAGCGTTAGAAAGCGCCCAGGCTAGATTGGCCGCGTTGTCCATCCTGGTCGGCGCC
GTGGGTGCCACCGGGCCGGGCGTCATGATAACGATCGACGATCCGGGACCCGGAGTAGCG
CCTGAGGTGATGATCGACGTGATCAACGAACTGCGTGCCGCTGGAGCCGAGGCGATCCAG
ATCAACGATGCACACCGGTCGGTGCGGGTCGGGGTTGACACCTGGGTTGTCGGTGTGCCC
GGCTCACTGACAGTCGACACCAAGGTCCTGTCCCCGCCGTATTCGATTCTGGCGATTGGT
GATCCTCCAACGCTGGCCGCGGCGATGAACATTCCTGGTGGTGCACAGGACGGTGTCAAA
CGCGTCGGCGGGCGGATGGTTGTGCAGCAGGCCGACCGTGTGGACGTGACCGCCTTGCGG
CAACCAAAACAGCACCAATACGCTCAGCCCGTCAAGTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Transcription Rv1826	active	madhulsbu	2012-10-05
	Co-expression (Functional linkage) D. Homerova,K. Surdova,K. Mikusova,J. Kormanec Identification of promoters recognized by RNA polymerase containing Mycobacterium tuberculosis stress-response sigma factor sigma(F). Arch. Microbiol. 2007
Interaction	Transcription Rv1826	active	madhulsbu	2012-10-05
	Co-expression (Functional linkage) EP. Williams, JH. Lee et al. Mycobacterium tuberculosis SigF regulates genes encoding cell wall-associated proteins and directly regulates the transcriptional regulatory gene phoY1. J. Bacteriol. 2007
Interaction	Transcription Rv1826	active	sourish10	2012-10-05
	Co-expression (Functional linkage) D. Homerova,K. Surdova,K. Mikusova,J. Kormanec Identification of promoters recognized by RNA polymerase containing Mycobacterium tuberculosis stress-response sigma factor sigma(F). Arch. Microbiol. 2007
Interaction	Transcription Rv1824	active	sourish10	2012-10-05
	Co-expression (Functional linkage) D. Homerova,K. Surdova,K. Mikusova,J. Kormanec Identification of promoters recognized by RNA polymerase containing Mycobacterium tuberculosis stress-response sigma factor sigma(F). Arch. Microbiol. 2007
Interaction	Transcription Rv1823	active	sourish10	2012-10-05
	Co-expression (Functional linkage) D. Homerova,K. Surdova,K. Mikusova,J. Kormanec Identification of promoters recognized by RNA polymerase containing Mycobacterium tuberculosis stress-response sigma factor sigma(F). Arch. Microbiol. 2007
Interaction	Transcription Rv1826	active	sourish10	2012-10-05
	Co-expression (Functional linkage) EP. Williams, JH. Lee et al. Mycobacterium tuberculosis SigF regulates genes encoding cell wall-associated proteins and directly regulates the transcriptional regulatory gene phoY1. J. Bacteriol. 2007
Interaction	Transcription Rv1824	active	sourish10	2012-10-05
	Co-expression (Functional linkage) EP. Williams, JH. Lee et al. Mycobacterium tuberculosis SigF regulates genes encoding cell wall-associated proteins and directly regulates the transcriptional regulatory gene phoY1. J. Bacteriol. 2007
Interaction	Transcription Rv1823	active	sourish10	2012-10-05
	Co-expression (Functional linkage) EP. Williams, JH. Lee et al. Mycobacterium tuberculosis SigF regulates genes encoding cell wall-associated proteins and directly regulates the transcriptional regulatory gene phoY1. J. Bacteriol. 2007
Interaction	Transcription Rv1824	active	madhulsbu	2012-10-05
	Co-expression (Functional linkage) D. Homerova,K. Surdova,K. Mikusova,J. Kormanec Identification of promoters recognized by RNA polymerase containing Mycobacterium tuberculosis stress-response sigma factor sigma(F). Arch. Microbiol. 2007
Interaction	Transcription Rv1824	active	madhulsbu	2012-10-05
	Co-expression (Functional linkage) EP. Williams, JH. Lee et al. Mycobacterium tuberculosis SigF regulates genes encoding cell wall-associated proteins and directly regulates the transcriptional regulatory gene phoY1. J. Bacteriol. 2007
Interaction	Transcription Rv1823	active	madhulsbu	2012-10-05
	Co-expression (Functional linkage) D. Homerova,K. Surdova,K. Mikusova,J. Kormanec Identification of promoters recognized by RNA polymerase containing Mycobacterium tuberculosis stress-response sigma factor sigma(F). Arch. Microbiol. 2007
Interaction	Transcription Rv1823	active	madhulsbu	2012-10-05
	Co-expression (Functional linkage) EP. Williams, JH. Lee et al. Mycobacterium tuberculosis SigF regulates genes encoding cell wall-associated proteins and directly regulates the transcriptional regulatory gene phoY1. J. Bacteriol. 2007
Interaction	RegulatedBy Rv3286c	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. EP. Williams, JH. Lee et al. Mycobacterium tuberculosis SigF regulates genes encoding cell wall-associated proteins and directly regulates the transcriptional regulatory gene phoY1. J. Bacteriol. 2007