Rv1884c - resuscitation-promoting factor rpfC

Expression: Most Significant Conditions for Rv1884c

Protein Domains

Gene Information
Locus	Rv1884c
Symbol	rpfC
Gene Name	resuscitation-promoting factor rpfC
Location	2133731 - 2134261 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:531 bp Protein:177 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	21624
Related Genes	MAP1607c MAV_2818 ML2030 MT1932 MUL_2975
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv1884c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv1884c Transcript 1
MHPLPADHGRSRCNRHPISPLSLIGNASATSGDMSSMTRIAKPLIKSAMAAGLVTASMSL
STAVAHAGPSPNWDAVAQCESGGNWAANTGNGKYGGLQFKPATWAAFGGVGNPAAASREQ
QIAVANRVLAEQGLDAWPTCGAASGLPIALWSKPAQGIKQIINEIIWAGIQASIPR*

Genomic Sequence

>Rv1884c
GTGCATCCTTTGCCGGCCGACCACGGCCGGTCGCGGTGCAATAGACACCCGATCTCACCA
CTCTCTCTAATCGGTAACGCTTCGGCCACTTCCGGCGATATGTCGAGCATGACAAGAATC
GCCAAGCCGCTCATCAAGTCCGCCATGGCCGCAGGACTCGTCACGGCATCCATGTCGCTC
TCCACCGCCGTTGCCCACGCCGGTCCCAGCCCGAACTGGGACGCCGTCGCGCAGTGCGAA
TCCGGGGGCAACTGGGCGGCCAACACCGGAAACGGCAAATACGGCGGACTGCAGTTCAAG
CCGGCCACCTGGGCCGCATTCGGCGGTGTCGGCAACCCAGCAGCTGCCTCTCGGGAACAA
CAAATCGCAGTTGCCAATCGGGTTCTCGCCGAACAGGGATTGGACGCGTGGCCGACGTGC
GGCGCCGCCTCTGGCCTTCCGATCGCACTGTGGTCGAAACCCGCGCAGGGCATCAAGCAA
ATCATCAACGAGATCATTTGGGCAGGCATTCAGGCAAGTATTCCGCGCTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Regulatory Rv3414c	active	swatigandhi19	2012-10-05
	Co-expression(Functional Linkage) S. Raman, R. Hazra et al. Transcription regulation by the Mycobacterium tuberculosis alternative sigma factor SigD and its role in virulence. J. Bacteriol. 2004
Interaction	Regulatory Rv3414c	active	swatigandhi19	2012-10-05
	Co-expression(Functional Linkage) H. Calamita, C. Ko et al. The Mycobacterium tuberculosis SigD sigma factor controls the expression of ribosome-associated gene products in stationary phase and is required for full virulence. Cell. Microbiol. 2005
Interaction	Regulatory Rv2389c	active	sourish10	2012-10-05
	Co-expression (Functional linkage) KJ. Downing, JC. Betts et al. Global expression profiling of strains harbouring null mutations reveals that the five rpf-like genes of Mycobacterium tuberculosis show functional redundancy. Tuberculosis (Edinburgh, Scotland) 2004
Interaction	RegulatedBy Rv0182c	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. JH. Lee, DE. Geiman et al. Role of stress response sigma factor SigG in Mycobacterium tuberculosis. J. Bacteriol. 2008
Interaction	RegulatedBy Rv0981	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. H. He, R. Hovey et al. MprAB is a stress-responsive two-component system that directly regulates expression of sigma factors SigB and SigE in Mycobacterium tuberculosis. J. Bacteriol. 2006
Interaction	RegulatedBy Rv1221	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. R. Manganelli, MI. Voskuil et al. The Mycobacterium tuberculosis ECF sigma factor sigmaE: role in global gene expression and survival in macrophages. Mol. Microbiol. 2001
Interaction	RegulatedBy Rv3414c	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Name	Resuscitation-promoting factor	active	mjackson	2012-10-05
	Peptidoglycan turnover