Rv1886c - secreted fibronectin-binding protein antigen 85-B fbpB

Expression: Most Significant Conditions for Rv1886c

Protein Domains

Gene Information
Locus	Rv1886c
Symbol	fbpB
Gene Name	secreted fibronectin-binding protein antigen 85-B fbpB
Location	2134890 - 2135867 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:978 bp Protein:326 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	21747
Related Genes	MAP1609c MAV_2816 Mkms_2817 ML2028 Mmcs_2773 MSMEG_3580 MT1934 MUL_2970 Mvan_3061
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv1886c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv1886c Transcript 1
MTDVSRKIRAWGRRLMIGTAAAVVLPGLVGLAGGAATAGAFSRPGLPVEYLQVPSPSMGR
DIKVQFQSGGNNSPAVYLLDGLRAQDDYNGWDINTPAFEWYYQSGLSIVMPVGGQSSFYS
DWYSPACGKAGCQTYKWETFLTSELPQWLSANRAVKPTGSAAIGLSMAGSSAMILAAYHP
QQFIYAGSLSALLDPSQGMGPSLIGLAMGDAGGYKAADMWGPSSDPAWERNDPTQQIPKL
VANNTRLWVYCGNGTPNELGGANIPAEFLENFVRSSNLKFQDAYNAAGGHNAVFNFPPNG
THSWEYWGAQLNAMKGDLQSSLGAG*

Genomic Sequence

>Rv1886c
ATGACAGACGTGAGCCGAAAGATTCGAGCTTGGGGACGCCGATTGATGATCGGCACGGCA
GCGGCTGTAGTCCTTCCGGGCCTGGTGGGGCTTGCCGGCGGAGCGGCAACCGCGGGCGCG
TTCTCCCGGCCGGGGCTGCCGGTCGAGTACCTGCAGGTGCCGTCGCCGTCGATGGGCCGC
GACATCAAGGTTCAGTTCCAGAGCGGTGGGAACAACTCACCTGCGGTTTATCTGCTCGAC
GGCCTGCGCGCCCAAGACGACTACAACGGCTGGGATATCAACACCCCGGCGTTCGAGTGG
TACTACCAGTCGGGACTGTCGATAGTCATGCCGGTCGGCGGGCAGTCCAGCTTCTACAGC
GACTGGTACAGCCCGGCCTGCGGTAAGGCTGGCTGCCAGACTTACAAGTGGGAAACCTTC
CTGACCAGCGAGCTGCCGCAATGGTTGTCCGCCAACAGGGCCGTGAAGCCCACCGGCAGC
GCTGCAATCGGCTTGTCGATGGCCGGCTCGTCGGCAATGATCTTGGCCGCCTACCACCCC
CAGCAGTTCATCTACGCCGGCTCGCTGTCGGCCCTGCTGGACCCCTCTCAGGGGATGGGG
CCTAGCCTGATCGGCCTCGCGATGGGTGACGCCGGCGGTTACAAGGCCGCAGACATGTGG
GGTCCCTCGAGTGACCCGGCATGGGAGCGCAACGACCCTACGCAGCAGATCCCCAAGCTG
GTCGCAAACAACACCCGGCTATGGGTTTATTGCGGGAACGGCACCCCGAACGAGTTGGGC
GGTGCCAACATACCCGCCGAGTTCTTGGAGAACTTCGTTCGTAGCAGCAACCTGAAGTTC
CAGGATGCGTACAACGCCGCGGGCGGGCACAACGCCGTGTTCAACTTCCCGCCCAACGGC
ACGCACAGCTGGGAGTACTGGGGCGCTCAGCTCAACGCCATGAAGGGTGACCTGCAGAGT
TCGTTAGGCGCCGGCTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	PhysicalInteraction Rv1911c	active	kaveri.verma	2012-10-05
	In vitro transposition reactions M. Braunstein,IV. Griffin TJ,JI. Kriakov,ST. Friedman,ND. Grindley,WR. Jacobs Identification of genes encoding exported Mycobacterium tuberculosis proteins using a Tn552'phoA in vitro transposition system. J. Bacteriol. 2000
Interaction	PhysicalInteraction Rv0129c	active	prabhakarsmail	2012-10-05
	structural analysis K. Takayama, C. Wang et al. Pathway to synthesis and processing of mycolic acids in Mycobacterium tuberculosis. Clin. Microbiol. Rev. 2005
Interaction	PhysicalInteraction Rv0129c	active	prabhakarsmail	2012-10-05
	structural analysis authors,N. Matluk,JA. Rochira,A. Karaczyn,T. Adams,JM. Verdi A role for NRAGE in NF-kappaB activation through the non-canonical BMP pathway. BMC Biol. 2010
Interaction	PhysicalInteraction Rv0129c	active	prabhakarsmail	2012-10-05
	structural analysis authors,G. Kumar,PK. Dagur,M. Singh,VS. Yadav,R. Dayal,HB. Singh,VM. Katoch,U. Sengupta,B. Joshi Diagnostic potential of Ag85C in comparison to various secretory antigens for childhood tuberculosis. Scand. J. Immunol. 2008
Interaction	PhysicalInteraction Rv0129c	active	prabhakarsmail	2012-10-05
	structural analysis authors,E. Lozes,K. Huygen,J. Content,O. Denis,DL. Montgomery,AM. Yawman,P. Vandenbussche,JP. Van Vooren,A. Drowart,JB. Ulmer,MA. Liu Immunogenicity and efficacy of a tuberculosis DNA vaccine encoding the components of the secreted antigen 85 complex. Vaccine 1997
Interaction	PhysicalInteraction Rv0129c	active	prabhakarsmail	2012-10-05
	structural analysis authors,DR. Ronning,T. Klabunde,GS. Besra,VD. Vissa,JT. Belisle,JC. Sacchettini Crystal structure of the secreted form of antigen 85C reveals potential targets for mycobacterial drugs and vaccines. Nat. Struct. Biol. 2000
Interaction	PhysicalInteraction Rv0129c	active	prabhakarsmail	2012-10-05
	Spectrophometric assay K. Takayama, C. Wang et al. Pathway to synthesis and processing of mycolic acids in Mycobacterium tuberculosis. Clin. Microbiol. Rev. 2005
Interaction	PhysicalInteraction Rv0129c	active	prabhakarsmail	2012-10-05
	Spectrophometric assay authors,N. Matluk,JA. Rochira,A. Karaczyn,T. Adams,JM. Verdi A role for NRAGE in NF-kappaB activation through the non-canonical BMP pathway. BMC Biol. 2010
Interaction	PhysicalInteraction Rv0129c	active	prabhakarsmail	2012-10-05
	Spectrophometric assay authors,G. Kumar,PK. Dagur,M. Singh,VS. Yadav,R. Dayal,HB. Singh,VM. Katoch,U. Sengupta,B. Joshi Diagnostic potential of Ag85C in comparison to various secretory antigens for childhood tuberculosis. Scand. J. Immunol. 2008
Interaction	PhysicalInteraction Rv0129c	active	prabhakarsmail	2012-10-05
	Spectrophometric assay authors,E. Lozes,K. Huygen,J. Content,O. Denis,DL. Montgomery,AM. Yawman,P. Vandenbussche,JP. Van Vooren,A. Drowart,JB. Ulmer,MA. Liu Immunogenicity and efficacy of a tuberculosis DNA vaccine encoding the components of the secreted antigen 85 complex. Vaccine 1997
Interaction	PhysicalInteraction Rv0129c	active	prabhakarsmail	2012-10-05
	Spectrophometric assay authors,DR. Ronning,T. Klabunde,GS. Besra,VD. Vissa,JT. Belisle,JC. Sacchettini Crystal structure of the secreted form of antigen 85C reveals potential targets for mycobacterial drugs and vaccines. Nat. Struct. Biol. 2000
Interaction	RegulatedBy Rv0348	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. B. Abomoelak, EA. Hoye et al. mosR, a novel transcriptional regulator of hypoxia and virulence in Mycobacterium tuberculosis. J. Bacteriol. 2009
Interaction	RegulatedBy Rv1221	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. R. Manganelli, MI. Voskuil et al. The Mycobacterium tuberculosis ECF sigma factor sigmaE: role in global gene expression and survival in macrophages. Mol. Microbiol. 2001
Name	mycolyltransferase 85B; INVOLVED IN CELL WALL MYCOLOYLATION	active	mjackson	2012-10-05
	Mycolic acid processing
Name	mycolyltransferase 85B; INVOLVED IN CELL WALL MYCOLOYLATION	active	mjackson	2012-10-05
	Mycolic acid processing
Term	EC:2.3.1.- Transferases. Acyltransferases. Transferring groups other than amino-acyl groups. - NR	active	extern:JZUCKER	2012-03-06
	Assay of protein purified to homogeneity from its native host authors,JT. Belisle,VD. Vissa,T. Sievert,K. Takayama,PJ. Brennan,GS. Besra Role of the major antigen of Mycobacterium tuberculosis in cell wall biogenesis. Science 1997
Term	EC:2.3.1.122 Trehalose O-mycolyltransferase. - NR	active	extern:JZUCKER	2012-03-06
	Assay of protein purified to homogeneity from its native host authors,JT. Belisle,VD. Vissa,T. Sievert,K. Takayama,PJ. Brennan,GS. Besra Role of the major antigen of Mycobacterium tuberculosis in cell wall biogenesis. Science 1997
Term	EC:2.3.1.- Transferases. Acyltransferases. Transferring groups other than amino-acyl groups. - NR	active	extern:JZUCKER	2012-03-06
	Inferred from mutant phenotype V. Puech, C. Guilhot et al. Evidence for a partial redundancy of the fibronectin-binding proteins for the transfer of mycoloyl residues onto the cell wall arabinogalactan termini of Mycobacterium tuberculosis. Mol. Microbiol. 2002
Term	EC:2.3.1.122 Trehalose O-mycolyltransferase. - NR	active	extern:JZUCKER	2012-03-06
	Inferred from mutant phenotype V. Puech, C. Guilhot et al. Evidence for a partial redundancy of the fibronectin-binding proteins for the transfer of mycoloyl residues onto the cell wall arabinogalactan termini of Mycobacterium tuberculosis. Mol. Microbiol. 2002
Term	EC:2.3.1.- Transferases. Acyltransferases. Transferring groups other than amino-acyl groups. - NR	active	jjmcfadden	2012-03-05
	Inferred from direct assay authors,DC. Crick,S. Mahapatra,PJ. Brennan Biosynthesis of the arabinogalactan-peptidoglycan complex of Mycobacterium tuberculosis. Glycobiology 2001