Rv1909c - ferric uptake regulation protein furA

Expression: Most Significant Conditions for Rv1909c

Protein Domains

Gene Information
Locus	Rv1909c
Symbol	furA
Gene Name	ferric uptake regulation protein furA
Location	2156149 - 2156601 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:453 bp Protein:151 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	33479
Related Genes	Acel_2095 MAP1669c MAV_2752 Mkms_2726 Mkms_4974 Mmcs_2681 Mmcs_4885 MSMEG_3460 MSMEG_6253 MSMEG_6383 MT1960 MUL_2189 Mvan_2983 Mvan_3209 nfa29490 nfa3250
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv1909c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv1909c Transcript 1
MSSVSSIPDYAEQLRTADLRVTRPRVAVLEAVNAHPHADTETIFGAVRFALPDVSRQAVY
DVLHALTAAGLVRKIQPSGSVARYESRVGDNHHHIVCRSCGVIADVDCAVGEAPCLTASD
HNGFLLDEAEVIYWGLCPDCSISDTSRSHP*

Genomic Sequence

>Rv1909c
TTGTCTAGTGTGTCCTCTATACCGGACTACGCCGAACAGCTCCGGACGGCCGACCTGCGC
GTGACCCGACCGCGCGTCGCCGTCCTGGAAGCAGTGAATGCGCATCCACACGCCGACACG
GAAACGATTTTCGGTGCCGTGCGTTTTGCGCTGCCCGACGTATCCCGGCAAGCCGTGTAC
GACGTGCTGCATGCCCTGACCGCCGCGGGCTTGGTGCGAAAGATCCAACCCTCGGGCTCC
GTCGCGCGCTACGAGTCCAGGGTCGGCGACAACCACCATCACATCGTCTGCCGGTCTTGC
GGGGTTATCGCCGATGTCGACTGTGCTGTTGGCGAGGCACCCTGTCTGACGGCCTCGGAC
CATAACGGCTTCCTGTTGGACGAGGCGGAGGTCATCTACTGGGGTCTATGTCCTGATTGT
TCGATATCCGACACTTCGCGATCACATCCGTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Transcription Rv1908c	active	kaveri.verma	2012-10-05
	Mutation studies AS. Pym, P. Domenech et al. Regulation of catalase-peroxidase (KatG) expression, isoniazid sensitivity and virulence by furA of Mycobacterium tuberculosis. Mol. Microbiol. 2001
Interaction	Regulatory Rv0117	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv3416	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv2034	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv0117	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv1909c	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv1909c	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008