Rv1969 - MCE-family protein mce3D

Expression: Most Significant Conditions for Rv1969

Protein Domains

Gene Information
Locus	Rv1969
Symbol	mce3D
Gene Name	MCE-family protein mce3D
Location	2212855 - 2214126 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:1272 bp Protein:424 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	22494
Related Genes	MAV_2535 Mkms_1681 Mmcs_1657 MT2021 MUL_2867 Mvan_0516 Mvan_0925
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv1969
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv1969 Transcript 1
MTTKLRRARSVLATALVLVAGVILAMRTADAAARTTVVAYFDNSNGVFAGDDVLIRGVPV
GKIVKIEPQPLRAKISFWFDRKYRVPADAAAAILSPQLVTGRAIQLTPPYAGGPTMADGT
VIPQERTVVPVEWDDLRAQLQRLTALLQPTRPGGVSTLGALINTAADNLRGQGATIRDTI
IKLSQAISALGDHSKDIFSTVTNLSTLVTALHDSADLLERLNHNLAAVTSLLADGPDKIG
QAAEDLNAVVADVGSFAAEHREAIGTASDKLASITTALVDSLDDIKQTLHISPTVLQNFN
NIFEPANGALTGALAGNNMANPIAFLCGAIQAASRLGGEQAAKLCVQYLAPIVKNRQYNY
PPLGANLFVGAQARPNEVTYSEDWLRPDYVAPVADTPPDPAAAVTVDPATGLRGMMMPPG
GGS*

Genomic Sequence

>Rv1969
GTGACAACGAAACTCAGACGTGCCCGCTCGGTGTTGGCGACCGCCCTGGTGCTGGTCGCG
GGCGTGATCCTGGCCATGCGCACCGCCGACGCCGCCGCCCGCACGACCGTGGTCGCCTAC
TTCGACAACAGCAACGGTGTGTTCGCCGGTGACGACGTGCTCATTCGGGGCGTGCCGGTG
GGCAAGATCGTCAAGATCGAACCGCAACCGCTGCGCGCCAAGATTTCGTTCTGGTTCGAC
CGCAAATACCGAGTCCCCGCCGATGCCGCCGCGGCGATCCTGTCGCCGCAACTGGTGACC
GGCCGGGCCATCCAGCTGACACCGCCGTATGCCGGCGGGCCGACCATGGCCGACGGCACA
GTAATCCCGCAAGAGCGCACCGTGGTGCCGGTGGAGTGGGACGACTTGCGGGCGCAACTT
CAGCGGCTGACCGCATTGCTGCAGCCCACCCGGCCGGGCGGCGTCAGCACGCTGGGTGCG
CTCATCAATACTGCCGCCGACAACCTGCGCGGGCAAGGCGCCACCATCCGCGACACCATC
ATCAAACTGTCACAAGCGATTTCGGCTCTCGGTGACCACAGCAAAGACATCTTCTCCACC
GTGACGAACCTGTCGACGCTGGTCACGGCGCTGCATGACAGCGCTGACCTGCTCGAACGG
CTCAACCACAACCTGGCCGCGGTGACCTCGCTGCTGGCCGATGGCCCGGACAAGATCGGT
CAGGCAGCCGAGGACCTCAACGCGGTCGTAGCCGACGTCGGCAGCTTCGCCGCCGAGCAC
CGCGAGGCGATCGGCACCGCATCAGACAAGCTCGCGTCAATCACCACCGCGCTGGTCGAC
AGCCTCGACGACATCAAGCAGACGCTGCATATCAGCCCGACGGTGTTGCAGAACTTCAAC
AACATCTTCGAACCGGCCAACGGCGCGCTGACCGGCGCGCTGGCGGGCAACAACATGGCC
AACCCAATCGCCTTCCTGTGCGGCGCGATCCAGGCTGCCTCCCGGCTGGGCGGCGAGCAA
GCGGCCAAATTGTGCGTGCAATACCTGGCGCCGATCGTGAAGAACCGCCAGTACAACTAC
CCGCCGCTGGGGGCGAACCTGTTCGTCGGGGCGCAGGCCAGGCCTAACGAGGTCACCTAC
AGCGAGGACTGGCTGCGGCCCGATTACGTTGCACCAGTTGCGGACACGCCGCCAGATCCG
GCCGCGGCCGTGACCGTCGATCCCGCGACCGGCCTGCGCGGCATGATGATGCCGCCGGGG
GGTGGCTCGTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	ActivatedBy Rv1975	active	priyadarshinipriyanka2001	2012-10-05
	Co-expression authors,MC. Garcia-Pelayo,KC. Caimi,JK. Inwald,J. Hinds,F. Bigi,MI. Romano,D. van Soolingen,RG. Hewinson,A. Cataldi,SV. Gordon Microarray analysis of Mycobacterium microti reveals deletion of genes encoding PE-PPE proteins and ESAT-6 family antigens. Tuberculosis (Edinb) 2004
Interaction	Regulatory Rv1971	active	sourish10	2012-10-05
	Coexpression(Functional linkage) S. Ahmad, S. El-Shazly et al. The six mammalian cell entry proteins (Mce3A-F) encoded by the mce3 operon are expressed during in vitro growth of Mycobacterium tuberculosis. Scand. J. Immunol. 2005
Interaction	Regulatory Rv1971	active	sourish10	2012-10-05
	Coexpression(Functional linkage) S. Ahmad, S. El-Shazly et al. Mammalian cell-entry proteins encoded by the mce3 operon of Mycobacterium tuberculosis are expressed during natural infection in humans. Scand. J. Immunol. 2004
Interaction	Regulatory Rv1971	active	ahal4789	2012-10-05
	Coexpression(Functional linkage) S. Ahmad, S. El-Shazly et al. The six mammalian cell entry proteins (Mce3A-F) encoded by the mce3 operon are expressed during in vitro growth of Mycobacterium tuberculosis. Scand. J. Immunol. 2005
Interaction	Regulatory Rv1971	active	ahal4789	2012-10-05
	Coexpression(Functional linkage) S. Ahmad, S. El-Shazly et al. Mammalian cell-entry proteins encoded by the mce3 operon of Mycobacterium tuberculosis are expressed during natural infection in humans. Scand. J. Immunol. 2004
Interaction	Regulatory Rv1971	active	sourish10	2012-10-05
	Coexpression(Functional linkage) S. Ahmad, S. El-Shazly et al. The six mammalian cell entry proteins (Mce3A-F) encoded by the mce3 operon are expressed during in vitro growth of Mycobacterium tuberculosis. Scand. J. Immunol. 2005
Interaction	Regulatory Rv1967	active	sourish10	2012-10-05
	Coexpression(Functional linkage) S. Ahmad, S. El-Shazly et al. The six mammalian cell entry proteins (Mce3A-F) encoded by the mce3 operon are expressed during in vitro growth of Mycobacterium tuberculosis. Scand. J. Immunol. 2005
Interaction	Regulatory Rv1968	active	sourish10	2012-10-05
	Coexpression(Functional linkage) S. Ahmad, S. El-Shazly et al. The six mammalian cell entry proteins (Mce3A-F) encoded by the mce3 operon are expressed during in vitro growth of Mycobacterium tuberculosis. Scand. J. Immunol. 2005
Interaction	Regulatory Rv1966	active	sourish10	2012-10-05
	Coexpression(Functional linkage) S. Ahmad, S. El-Shazly et al. The six mammalian cell entry proteins (Mce3A-F) encoded by the mce3 operon are expressed during in vitro growth of Mycobacterium tuberculosis. Scand. J. Immunol. 2005
Interaction	Regulatory Rv1963c	active	sourish10	2012-10-05
	Coexpression(Functional linkage) S. Ahmad, S. El-Shazly et al. The six mammalian cell entry proteins (Mce3A-F) encoded by the mce3 operon are expressed during in vitro growth of Mycobacterium tuberculosis. Scand. J. Immunol. 2005
Interaction	Regulatory Rv1971	active	sourish10	2012-10-05
	Coexpression(Functional linkage) S. Ahmad, S. El-Shazly et al. Mammalian cell-entry proteins encoded by the mce3 operon of Mycobacterium tuberculosis are expressed during natural infection in humans. Scand. J. Immunol. 2004
Interaction	Regulatory Rv1967	active	sourish10	2012-10-05
	Coexpression(Functional linkage) S. Ahmad, S. El-Shazly et al. Mammalian cell-entry proteins encoded by the mce3 operon of Mycobacterium tuberculosis are expressed during natural infection in humans. Scand. J. Immunol. 2004
Interaction	Regulatory Rv1968	active	sourish10	2012-10-05
	Coexpression(Functional linkage) S. Ahmad, S. El-Shazly et al. Mammalian cell-entry proteins encoded by the mce3 operon of Mycobacterium tuberculosis are expressed during natural infection in humans. Scand. J. Immunol. 2004
Interaction	Regulatory Rv1966	active	sourish10	2012-10-05
	Coexpression(Functional linkage) S. Ahmad, S. El-Shazly et al. Mammalian cell-entry proteins encoded by the mce3 operon of Mycobacterium tuberculosis are expressed during natural infection in humans. Scand. J. Immunol. 2004
Interaction	Regulatory Rv1963c	active	sourish10	2012-10-05
	Coexpression(Functional linkage) S. Ahmad, S. El-Shazly et al. Mammalian cell-entry proteins encoded by the mce3 operon of Mycobacterium tuberculosis are expressed during natural infection in humans. Scand. J. Immunol. 2004
Interaction	Regulatory Rv1971	active	ahal4789	2012-10-05
	Coexpression(Functional linkage) S. Ahmad, S. El-Shazly et al. The six mammalian cell entry proteins (Mce3A-F) encoded by the mce3 operon are expressed during in vitro growth of Mycobacterium tuberculosis. Scand. J. Immunol. 2005
Interaction	Regulatory Rv1967	active	ahal4789	2012-10-05
	Coexpression(Functional linkage) S. Ahmad, S. El-Shazly et al. The six mammalian cell entry proteins (Mce3A-F) encoded by the mce3 operon are expressed during in vitro growth of Mycobacterium tuberculosis. Scand. J. Immunol. 2005
Interaction	Regulatory Rv1968	active	ahal4789	2012-10-05
	Coexpression(Functional linkage) S. Ahmad, S. El-Shazly et al. The six mammalian cell entry proteins (Mce3A-F) encoded by the mce3 operon are expressed during in vitro growth of Mycobacterium tuberculosis. Scand. J. Immunol. 2005
Interaction	Regulatory Rv1966	active	ahal4789	2012-10-05
	Coexpression(Functional linkage) S. Ahmad, S. El-Shazly et al. The six mammalian cell entry proteins (Mce3A-F) encoded by the mce3 operon are expressed during in vitro growth of Mycobacterium tuberculosis. Scand. J. Immunol. 2005
Interaction	Regulatory Rv1963c	active	ahal4789	2012-10-05
	Coexpression(Functional linkage) S. Ahmad, S. El-Shazly et al. The six mammalian cell entry proteins (Mce3A-F) encoded by the mce3 operon are expressed during in vitro growth of Mycobacterium tuberculosis. Scand. J. Immunol. 2005
Interaction	Regulatory Rv1971	active	ahal4789	2012-10-05
	Coexpression(Functional linkage) S. Ahmad, S. El-Shazly et al. Mammalian cell-entry proteins encoded by the mce3 operon of Mycobacterium tuberculosis are expressed during natural infection in humans. Scand. J. Immunol. 2004
Interaction	Regulatory Rv1967	active	ahal4789	2012-10-05
	Coexpression(Functional linkage) S. Ahmad, S. El-Shazly et al. Mammalian cell-entry proteins encoded by the mce3 operon of Mycobacterium tuberculosis are expressed during natural infection in humans. Scand. J. Immunol. 2004
Interaction	Regulatory Rv1968	active	ahal4789	2012-10-05
	Coexpression(Functional linkage) S. Ahmad, S. El-Shazly et al. Mammalian cell-entry proteins encoded by the mce3 operon of Mycobacterium tuberculosis are expressed during natural infection in humans. Scand. J. Immunol. 2004
Interaction	Regulatory Rv1966	active	ahal4789	2012-10-05
	Coexpression(Functional linkage) S. Ahmad, S. El-Shazly et al. Mammalian cell-entry proteins encoded by the mce3 operon of Mycobacterium tuberculosis are expressed during natural infection in humans. Scand. J. Immunol. 2004
Interaction	Regulatory Rv1963c	active	ahal4789	2012-10-05
	Coexpression(Functional linkage) S. Ahmad, S. El-Shazly et al. Mammalian cell-entry proteins encoded by the mce3 operon of Mycobacterium tuberculosis are expressed during natural infection in humans. Scand. J. Immunol. 2004
Interaction	Regulatory Rv1968	active	sourish10	2012-10-05
	Coexpression(Functional linkage) S. Ahmad, S. El-Shazly et al. The six mammalian cell entry proteins (Mce3A-F) encoded by the mce3 operon are expressed during in vitro growth of Mycobacterium tuberculosis. Scand. J. Immunol. 2005
Interaction	Regulatory Rv1968	active	sourish10	2012-10-05
	Coexpression(Functional linkage) S. Ahmad, S. El-Shazly et al. Mammalian cell-entry proteins encoded by the mce3 operon of Mycobacterium tuberculosis are expressed during natural infection in humans. Scand. J. Immunol. 2004
Interaction	Regulatory Rv1968	active	ahal4789	2012-10-05
	Coexpression(Functional linkage) S. Ahmad, S. El-Shazly et al. The six mammalian cell entry proteins (Mce3A-F) encoded by the mce3 operon are expressed during in vitro growth of Mycobacterium tuberculosis. Scand. J. Immunol. 2005
Interaction	Regulatory Rv1968	active	ahal4789	2012-10-05
	Coexpression(Functional linkage) S. Ahmad, S. El-Shazly et al. Mammalian cell-entry proteins encoded by the mce3 operon of Mycobacterium tuberculosis are expressed during natural infection in humans. Scand. J. Immunol. 2004
Interaction	Regulatory Rv1967	active	sourish10	2012-10-05
	Coexpression(Functional linkage) S. Ahmad, S. El-Shazly et al. The six mammalian cell entry proteins (Mce3A-F) encoded by the mce3 operon are expressed during in vitro growth of Mycobacterium tuberculosis. Scand. J. Immunol. 2005
Interaction	Regulatory Rv1967	active	sourish10	2012-10-05
	Coexpression(Functional linkage) S. Ahmad, S. El-Shazly et al. Mammalian cell-entry proteins encoded by the mce3 operon of Mycobacterium tuberculosis are expressed during natural infection in humans. Scand. J. Immunol. 2004
Interaction	Regulatory Rv1967	active	ahal4789	2012-10-05
	Coexpression(Functional linkage) S. Ahmad, S. El-Shazly et al. The six mammalian cell entry proteins (Mce3A-F) encoded by the mce3 operon are expressed during in vitro growth of Mycobacterium tuberculosis. Scand. J. Immunol. 2005
Interaction	Regulatory Rv1967	active	ahal4789	2012-10-05
	Coexpression(Functional linkage) S. Ahmad, S. El-Shazly et al. Mammalian cell-entry proteins encoded by the mce3 operon of Mycobacterium tuberculosis are expressed during natural infection in humans. Scand. J. Immunol. 2004
Interaction	Regulatory Rv1966	active	sourish10	2012-10-05
	Coexpression(Functional linkage) S. Ahmad, S. El-Shazly et al. The six mammalian cell entry proteins (Mce3A-F) encoded by the mce3 operon are expressed during in vitro growth of Mycobacterium tuberculosis. Scand. J. Immunol. 2005
Interaction	Regulatory Rv1966	active	sourish10	2012-10-05
	Coexpression(Functional linkage) S. Ahmad, S. El-Shazly et al. Mammalian cell-entry proteins encoded by the mce3 operon of Mycobacterium tuberculosis are expressed during natural infection in humans. Scand. J. Immunol. 2004
Interaction	Regulatory Rv1966	active	sourish10	2012-10-05
	Coexpression(Functional linkage) D. Mitra, B. Saha et al. Correlating sequential homology of Mce1A, Mce2A, Mce3A and Mce4A with their possible functions in mammalian cell entry of Mycobacterium tuberculosis performing homology modeling. Tuberculosis (Edinburgh, Scotland) null
Interaction	Regulatory Rv1966	active	ahal4789	2012-10-05
	Coexpression(Functional linkage) S. Ahmad, S. El-Shazly et al. The six mammalian cell entry proteins (Mce3A-F) encoded by the mce3 operon are expressed during in vitro growth of Mycobacterium tuberculosis. Scand. J. Immunol. 2005
Interaction	Regulatory Rv1966	active	ahal4789	2012-10-05
	Coexpression(Functional linkage) S. Ahmad, S. El-Shazly et al. Mammalian cell-entry proteins encoded by the mce3 operon of Mycobacterium tuberculosis are expressed during natural infection in humans. Scand. J. Immunol. 2004
Interaction	Regulatory Rv1966	active	ahal4789	2012-10-05
	Coexpression(Functional linkage) D. Mitra, B. Saha et al. Correlating sequential homology of Mce1A, Mce2A, Mce3A and Mce4A with their possible functions in mammalian cell entry of Mycobacterium tuberculosis performing homology modeling. Tuberculosis (Edinburgh, Scotland) null