Rv1994c - transcriptional regulator

Expression: Most Significant Conditions for Rv1994c

Protein Domains

Gene Information
Locus	Rv1994c
Symbol
Gene Name	transcriptional regulator
Location	2237628 - 2237984 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:357 bp Protein:119 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	31263
Related Genes	Mkms_4255 Mmcs_4189 MSMEG_5603 MT2050 Mvan_3937 nfa26300
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv1994c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv1994c Transcript 1
MLTCEMRESALARLGRALADPTRCRILVALLDGVCYPGQLAAHLGLTRSNVSNHLSCLRG
CGLVVATYEGRQVRYALADSHLARALGELVQVVLAVDTDQPCVAERAASGEAVEMTGS*

Genomic Sequence

>Rv1994c
ATGCTGACGTGTGAGATGCGGGAATCGGCCCTGGCTCGACTCGGCCGGGCTCTGGCTGAT
CCGACGCGGTGCCGGATTCTGGTGGCGTTGCTGGATGGCGTTTGCTATCCCGGCCAGCTA
GCTGCGCACCTCGGGTTGACCCGATCGAATGTGTCCAACCATCTGTCGTGTTTGCGGGGC
TGCGGGCTGGTAGTCGCAACCTATGAGGGCCGGCAGGTTCGGTATGCGCTGGCCGACAGT
CACCTGGCGCGAGCCTTGGGCGAGTTGGTCCAGGTCGTTCTCGCGGTGGATACCGACCAA
CCCTGTGTCGCCGAGCGCGCCGCGTCCGGGGAGGCGGTCGAGATGACAGGTAGCTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Regulatory Rv1992c	active	priyadarshinipriyanka2001	2012-10-05
	Co-expression (Functional linkage) R. Manganelli, MI. Voskuil et al. Role of the extracytoplasmic-function sigma factor sigma(H) in Mycobacterium tuberculosis global gene expression. Mol. Microbiol. 2002
Interaction	Regulatory Rv1992c	active	priyadarshinipriyanka2001	2012-10-05
	Co-expression (Functional linkage) authors,SK. Ward,B. Abomoelak,EA. Hoye,H. Steinberg,AM. Talaat CtpV: a putative copper exporter required for full virulence of Mycobacterium tuberculosis. Mol. Microbiol. 2010
Interaction	Transcription Rv1674c	active	shahanup86	2012-10-05
	Co-expression (Functional Linkage) Y. Kong, MD. Cave et al. Population-based study of deletions in five different genomic regions of Mycobacterium tuberculosis and possible clinical relevance of the deletions. J. Clin. Microbiol. 2006
Interaction	Transcription Rv1674c	active	shahanup86	2012-10-05
	Co-expression (Functional Linkage) F. Canneva, M. Branzoni et al. Rv2358 and FurB: two transcriptional regulators from Mycobacterium tuberculosis which respond to zinc. J. Bacteriol. 2005
Interaction	RegulatedBy Rv1994c	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv1994c	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008