Rv2007c - ferredoxin fdxA

Expression: Most Significant Conditions for Rv2007c

Protein Domains

Gene Information
Locus	Rv2007c
Symbol	fdxA
Gene Name	ferredoxin fdxA
Location	2256084 - 2256428 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:345 bp Protein:115 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	35599
Related Genes	Mkms_2763 Mkms_5378 Mmcs_2719 Mmcs_5289 MT2063 Mvan_0299
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv2007c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv2007c Transcript 1
MTYVIGSECVDVMDKSCVQECPVDCIYEGARMLYINPDECVDCGACKPACRVEAIYWEGD
LPDDQHQHLGDNAAFFHQVLPGRVAPLGSPGGAAAVGPIGVDTPLVAAIPVECP*

Genomic Sequence

>Rv2007c
GTGACCTATGTGATCGGTAGTGAGTGCGTGGATGTGATGGACAAGTCCTGTGTGCAGGAG
TGTCCGGTCGACTGTATCTATGAGGGCGCCCGAATGCTCTACATCAACCCCGACGAGTGC
GTGGATTGTGGTGCGTGCAAACCGGCCTGCCGCGTCGAGGCGATCTACTGGGAAGGCGAT
CTACCCGACGATCAACACCAGCATCTGGGGGACAACGCCGCCTTTTTCCACCAAGTCCTG
CCGGGCCGAGTGGCTCCGCTGGGTTCGCCGGGTGGTGCCGCAGCGGTGGGCCCGATCGGA
GTCGACACGCCTCTGGTCGCGGCTATCCCGGTGGAGTGCCCTTAG

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Regulatory Rv3133c	active	prabhakarsmail	2012-10-05
	co-expression(Functional linkage) A. Kumar,JC. Toledo,RP. Patel,JR. Lancaster,AJ. Steyn Mycobacterium tuberculosis DosS is a redox sensor and DosT is a hypoxia sensor. Proc. Natl. Acad. Sci. U.S.A. 2007
Interaction	Regulatory Rv2031c	active	prabhakarsmail	2012-10-05
	co-expression(Functional linkage) A. Kumar,JC. Toledo,RP. Patel,JR. Lancaster,AJ. Steyn Mycobacterium tuberculosis DosS is a redox sensor and DosT is a hypoxia sensor. Proc. Natl. Acad. Sci. U.S.A. 2007
Interaction	Regulatory Rv3133c	active	akankshajain.21	2012-10-05
	co-expression(Functional linkage) A. Kumar,JC. Toledo,RP. Patel,JR. Lancaster,AJ. Steyn Mycobacterium tuberculosis DosS is a redox sensor and DosT is a hypoxia sensor. Proc. Natl. Acad. Sci. U.S.A. 2007
Interaction	Regulatory Rv2031c	active	akankshajain.21	2012-10-05
	co-expression(Functional linkage) A. Kumar,JC. Toledo,RP. Patel,JR. Lancaster,AJ. Steyn Mycobacterium tuberculosis DosS is a redox sensor and DosT is a hypoxia sensor. Proc. Natl. Acad. Sci. U.S.A. 2007
Interaction	RegulatedBy Rv0981	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. H. He, R. Hovey et al. MprAB is a stress-responsive two-component system that directly regulates expression of sigma factors SigB and SigE in Mycobacterium tuberculosis. J. Bacteriol. 2006
Interaction	RegulatedBy Rv3133c	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008