Rv2094c - SEC-independent protein translocase membrane-bound protein tatA

Expression: Most Significant Conditions for Rv2094c

Protein Domains

Gene Information
Locus	Rv2094c
Symbol	tatA
Gene Name	SEC-independent protein translocase membrane-bound protein tatA
Location	2353046 - 2353297 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:252 bp Protein:84 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	22099
Related Genes	CE1620 cg1685 DIP1242 jk0942 MAP1830c MAV_2409 Mkms_2519 ML1331 Mmcs_2474 MSMEG_3887 MT2155 MUL_2326 Mvan_3442 nfa31640
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv2094c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv2094c Transcript 1
MGSLSPWHWAILAVVVIVLFGAKKLPDAARSLGKSLRIFKSEVRELQNENKAEASIETPT
PVQSQRVDPSAASGQDSTEARPA*

Genomic Sequence

>Rv2094c
GTGGGCAGTCTGAGTCCGTGGCATTGGGCGATCCTCGCTGTCGTGGTGATCGTGTTGTTC
GGTGCCAAGAAGCTCCCCGATGCGGCGCGCTCGTTGGGCAAGTCATTGCGAATCTTTAAG
TCCGAGGTCCGTGAACTGCAGAACGAGAACAAAGCGGAAGCGTCTATCGAGACCCCCACG
CCGGTGCAATCGCAGCGTGTCGACCCCTCAGCGGCGTCTGGTCAAGACAGCACCGAGGCT
CGGCCGGCTTAG

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	PhysicalInteraction Rv2525c	active	kandarpbioinfo	2012-10-05
	ChIP (Physical interaction) JA. McDonough, JR. McCann et al. Identification of functional Tat signal sequences in Mycobacterium tuberculosis proteins. J. Bacteriol. 2008
Interaction	PhysicalInteraction Rv2525c	active	kandarpbioinfo	2012-10-05
	ChIP (Physical interaction) B. Saint-Joanis, C. Demangel et al. Inactivation of Rv2525c, a substrate of the twin arginine translocation (Tat) system of Mycobacterium tuberculosis, increases beta-lactam susceptibility and virulence. J. Bacteriol. 2006
Interaction	PhysicalInteraction Rv2068c	active	ashwinigbhat	2012-10-05
	Spectrophotometric Analysis JA. McDonough, KE. Hacker et al. The twin-arginine translocation pathway of Mycobacterium smegmatis is functional and required for the export of mycobacterial beta-lactamases. J. Bacteriol. 2005
Interaction	PhysicalInteraction Rv2068c	active	ashwinigbhat	2012-10-05
	Spectrophotometric Analysis JE. Posey, TM. Shinnick et al. Characterization of the twin-arginine translocase secretion system of Mycobacterium smegmatis. J. Bacteriol. 2006
Interaction	PhysicalInteraction Rv2068c	active	priti.priety	2012-10-05
	Spectrophotometric Analysis JA. McDonough, KE. Hacker et al. The twin-arginine translocation pathway of Mycobacterium smegmatis is functional and required for the export of mycobacterial beta-lactamases. J. Bacteriol. 2005
Interaction	PhysicalInteraction Rv2068c	active	priti.priety	2012-10-05
	Spectrophotometric Analysis JE. Posey, TM. Shinnick et al. Characterization of the twin-arginine translocase secretion system of Mycobacterium smegmatis. J. Bacteriol. 2006
Interaction	Operon Rv1224	active	gaat3s	2012-10-05
	Gene Neighbourhood(Functional Linkage) JA. McDonough, KE. Hacker et al. The twin-arginine translocation pathway of Mycobacterium smegmatis is functional and required for the export of mycobacterial beta-lactamases. J. Bacteriol. 2005
Interaction	Operon Rv1224	active	gaat3s	2012-10-05
	Gene Neighbourhood(Functional Linkage) authors,BC. Berks,F. Sargent,T. Palmer The Tat protein export pathway. Mol. Microbiol. 2000
Interaction	Operon Rv1224	active	gaat3s	2012-10-05
	Gene Neighbourhood(Functional Linkage) JE. Posey, TM. Shinnick et al. Characterization of the twin-arginine translocase secretion system of Mycobacterium smegmatis. J. Bacteriol. 2006
Interaction	RegulatedBy Rv1221	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. PA. Fontán, V. Aris et al. Mycobacterium tuberculosis Sigma Factor E Regulon Modulates the Host Inflammatory Response. J. Infect. Dis. 2008
Interaction	RegulatedBy Rv1221	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. PA. Fontán, V. Aris et al. Mycobacterium tuberculosis Sigma Factor E Regulon Modulates the Host Inflammatory Response. J. Infect. Dis. 2008