Rv2097c - conserved hypothetical protein

Expression: Most Significant Conditions for Rv2097c

Protein Domains

Gene Information
Locus	Rv2097c
Symbol
Gene Name	conserved hypothetical protein
Location	2355319 - 2356677 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:1359 bp Protein:453 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	33225
Related Genes	CE1623 CE1625 cg1688 cg1690 DIP1245 DIP1247 jk0945 jk0947 MAP1833c MAP1837c MAV_2406 Mkms_2512 Mkms_3193 ML1320 ML1328 Mmcs_2467 Mmcs_3131 MSMEG_3890 MSMEG_3897 MT2158 MT2172 MUL_2329 MUL_2333 Mvan_3445 Mvan_3451 nfa31700 nfa31740 Rv2112c
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv2097c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv2097c Transcript 1
MQRRIMGIETEFGVTCTFHGHRRLSPDEVARYLFRRVVSWGRSSNVFLRNGARLYLDVGS
HPEYATAECDSLVQLVTHDRAGEWVLEDLLVDAEQRLADEGIGGDIYLFKNNTDSAGNSY
GCHENYLIVRAGEFSRISDVLLPFLVTRQLICGAGKVLQTPKAATYCLSQRAEHIWEGVS
SATTRSRPIINTRDEPHADAEKYRRLHVIVGDSNMSETTTMLKVGTAALVLEMIESGVAF
RDFSLDNPIRAIREVSHDVTGRRPVRLAGGRQASALDIQREYYTRAVEHLQTREPNAQIE
QVVDLWGRQLDAVESQDFAKVDTEIDWVIKRKLFQRYQDRYDMELSHPKIAQLDLAYHDI
KRGRGIFDLLQRKGLAARVTTDEEIAEAVDQPPQTTRARLRGEFISAAQEAGRDFTVDWV
HLKLNDQAQRTVLCKDPFRAVDERVKRLIASM*

Genomic Sequence

>Rv2097c
GTGCAGCGTCGAATCATGGGCATCGAAACCGAGTTCGGTGTCACCTGCACATTTCACGGT
CACCGTCGGCTGTCCCCGGACGAGGTGGCCCGCTACCTGTTTCGCCGTGTGGTGTCCTGG
GGCCGCAGCTCCAACGTCTTCCTGCGTAACGGTGCGCGCCTGTATCTCGACGTGGGCAGT
CATCCCGAGTACGCCACCGCCGAATGCGACAGCCTGGTGCAGCTGGTCACCCATGACCGG
GCCGGTGAATGGGTGCTGGAAGACCTGCTCGTTGACGCCGAGCAGCGGCTGGCCGACGAG
GGCATCGGCGGCGACATCTACCTGTTCAAGAACAACACCGATTCGGCGGGCAACTCCTAC
GGCTGCCACGAAAACTACCTGATCGTGCGGGCCGGTGAGTTCTCCCGGATCTCCGACGTG
CTGCTGCCCTTCCTGGTCACCCGCCAGCTGATCTGCGGGGCCGGCAAGGTGCTGCAGACC
CCCAAGGCCGCCACCTACTGCTTAAGCCAACGCGCCGAACACATTTGGGAGGGCGTCTCT
AGCGCCACGACCCGATCCCGCCCCATTATCAACACCCGCGACGAGCCACATGCCGACGCC
GAGAAGTACCGGCGGCTGCACGTCATCGTCGGCGACTCCAACATGTCCGAGACCACCACC
ATGCTCAAGGTGGGCACCGCGGCGCTCGTGCTGGAAATGATCGAAAGTGGAGTCGCCTTC
CGTGATTTTTCCCTGGATAACCCGATCCGCGCCATCCGTGAGGTTAGCCATGATGTCACC
GGTCGCCGGCCGGTGCGGTTGGCCGGAGGCCGTCAGGCCAGCGCGCTGGACATCCAGCGG
GAGTACTACACCCGCGCAGTCGAGCACTTGCAGACTCGGGAGCCCAACGCGCAGATCGAG
CAGGTCGTCGACCTGTGGGGCCGCCAACTCGATGCCGTCGAAAGCCAGGATTTCGCCAAG
GTCGACACCGAAATCGACTGGGTGATCAAACGCAAGCTGTTTCAGCGTTATCAGGACCGC
TATGACATGGAGTTGTCCCACCCGAAGATCGCTCAGCTGGATCTGGCCTACCACGACATC
AAGCGCGGACGCGGGATCTTTGATCTCCTGCAGCGCAAAGGGTTGGCCGCGCGCGTCACC
ACCGACGAAGAAATCGCGGAGGCCGTCGATCAGCCCCCACAGACCACCCGGGCCCGGCTG
CGCGGTGAGTTCATCAGCGCCGCGCAGGAGGCGGGACGTGATTTCACCGTCGACTGGGTA
CATCTCAAACTCAACGACCAGGCGCAGCGCACCGTGCTGTGCAAAGACCCGTTCCGGGCG
GTCGATGAGCGGGTTAAGCGGCTGATCGCGAGCATGTAG

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Regulatory Rv2115c	active	sourish10	2012-10-05
	Structural Analysis authors,DM. Ritchie,JN. Sierchio,RJ. Capetola,ME. Rosenthale SRS-A mediated bronchospasm by pharmacologic modification of lung anaphylaxis in vivo. Agents Actions 1981
Interaction	Regulatory Rv2115c	active	sourish10	2012-10-05
	Structural Analysis KH. Darwin, S. Ehrt et al. The proteasome of Mycobacterium tuberculosis is required for resistance to nitric oxide. Science 2003
Interaction	Regulatory Rv2115c	active	sourish10	2012-10-05
	Structural Analysis KH. Darwin, G. Lin et al. Characterization of a Mycobacterium tuberculosis proteasomal ATPase homologue. Mol. Microbiol. 2005
Interaction	Regulatory Rv2115c	active	sourish10	2012-10-05
	Structural Analysis M. Sutter,F. Striebel,FF. Damberger,FH. Allain,E. Weber-Ban A distinct structural region of the prokaryotic ubiquitin-like protein (Pup) is recognized by the N-terminal domain of the proteasomal ATPase Mpa. FEBS Lett. 2009
Interaction	Regulatory Rv2115c	active	sourish10	2012-10-05
	Spectrophotometric Analysis authors,DM. Ritchie,JN. Sierchio,RJ. Capetola,ME. Rosenthale SRS-A mediated bronchospasm by pharmacologic modification of lung anaphylaxis in vivo. Agents Actions 1981
Interaction	Regulatory Rv2115c	active	sourish10	2012-10-05
	Spectrophotometric Analysis KH. Darwin, S. Ehrt et al. The proteasome of Mycobacterium tuberculosis is required for resistance to nitric oxide. Science 2003
Interaction	Regulatory Rv2115c	active	sourish10	2012-10-05
	Spectrophotometric Analysis KH. Darwin, G. Lin et al. Characterization of a Mycobacterium tuberculosis proteasomal ATPase homologue. Mol. Microbiol. 2005
Interaction	Regulatory Rv2115c	active	sourish10	2012-10-05
	Spectrophotometric Analysis M. Sutter,F. Striebel,FF. Damberger,FH. Allain,E. Weber-Ban A distinct structural region of the prokaryotic ubiquitin-like protein (Pup) is recognized by the N-terminal domain of the proteasomal ATPase Mpa. FEBS Lett. 2009
Interaction	Regulatory Rv2115c	active	ahal4789	2012-10-05
	Structural Analysis authors,DM. Ritchie,JN. Sierchio,RJ. Capetola,ME. Rosenthale SRS-A mediated bronchospasm by pharmacologic modification of lung anaphylaxis in vivo. Agents Actions 1981
Interaction	Regulatory Rv2115c	active	ahal4789	2012-10-05
	Structural Analysis KH. Darwin, S. Ehrt et al. The proteasome of Mycobacterium tuberculosis is required for resistance to nitric oxide. Science 2003
Interaction	Regulatory Rv2115c	active	ahal4789	2012-10-05
	Structural Analysis KH. Darwin, G. Lin et al. Characterization of a Mycobacterium tuberculosis proteasomal ATPase homologue. Mol. Microbiol. 2005
Interaction	Regulatory Rv2115c	active	ahal4789	2012-10-05
	Structural Analysis M. Sutter,F. Striebel,FF. Damberger,FH. Allain,E. Weber-Ban A distinct structural region of the prokaryotic ubiquitin-like protein (Pup) is recognized by the N-terminal domain of the proteasomal ATPase Mpa. FEBS Lett. 2009
Interaction	Regulatory Rv2115c	active	ahal4789	2012-10-05
	Spectrophotometric Analysis authors,DM. Ritchie,JN. Sierchio,RJ. Capetola,ME. Rosenthale SRS-A mediated bronchospasm by pharmacologic modification of lung anaphylaxis in vivo. Agents Actions 1981
Interaction	Regulatory Rv2115c	active	ahal4789	2012-10-05
	Spectrophotometric Analysis KH. Darwin, S. Ehrt et al. The proteasome of Mycobacterium tuberculosis is required for resistance to nitric oxide. Science 2003
Interaction	Regulatory Rv2115c	active	ahal4789	2012-10-05
	Spectrophotometric Analysis KH. Darwin, G. Lin et al. Characterization of a Mycobacterium tuberculosis proteasomal ATPase homologue. Mol. Microbiol. 2005
Interaction	Regulatory Rv2115c	active	ahal4789	2012-10-05
	Spectrophotometric Analysis M. Sutter,F. Striebel,FF. Damberger,FH. Allain,E. Weber-Ban A distinct structural region of the prokaryotic ubiquitin-like protein (Pup) is recognized by the N-terminal domain of the proteasomal ATPase Mpa. FEBS Lett. 2009
Interaction	Activation Rv2111c	active	priyadarshinipriyanka2001	2012-10-05
	Affinity purification (Physical interaction) MJ. Pearce, J. Mintseris et al. Ubiquitin-like protein involved in the proteasome pathway of Mycobacterium tuberculosis. Science 2008
Interaction	Activation Rv2111c	active	priyadarshinipriyanka2001	2012-10-05
	Affinity purification (Physical interaction) F. Striebel, F. Imkamp et al. Bacterial ubiquitin-like modifier Pup is deamidated and conjugated to substrates by distinct but homologous enzymes. Nat. Struct. Mol. Biol. 2009
Interaction	Activation Rv2111c	active	priyadarshinipriyanka2001	2012-10-05
	Affinity purification (Physical interaction) F. Imkamp,T. Rosenberger,F. Striebel,PM. Keller,B. Amstutz,P. Sander,E. Weber-Ban Deletion of dop in Mycobacterium smegmatis abolishes pupylation of protein substrates in vivo. Mol. Microbiol. 2010
Interaction	PhysicalInteraction Rv2096c	active	ahal4789	2012-10-05
	Affinity purification (Physical interaction) authors,RA. Festa,MJ. Pearce,KH. Darwin Characterization of the proteasome accessory factor (paf) operon in Mycobacterium tuberculosis. J. Bacteriol. 2007
Interaction	PhysicalInteraction Rv2095c	active	ahal4789	2012-10-05
	Affinity purification (Physical interaction) authors,RA. Festa,MJ. Pearce,KH. Darwin Characterization of the proteasome accessory factor (paf) operon in Mycobacterium tuberculosis. J. Bacteriol. 2007
Interaction	PhysicalInteraction Rv2096c	active	sourish10	2012-10-05
	Affinity purification (Physical interaction) authors,RA. Festa,MJ. Pearce,KH. Darwin Characterization of the proteasome accessory factor (paf) operon in Mycobacterium tuberculosis. J. Bacteriol. 2007
Interaction	PhysicalInteraction Rv2095c	active	sourish10	2012-10-05
	Affinity purification (Physical interaction) authors,RA. Festa,MJ. Pearce,KH. Darwin Characterization of the proteasome accessory factor (paf) operon in Mycobacterium tuberculosis. J. Bacteriol. 2007