Rv2111c - conserved hypothetical protein

Expression: Most Significant Conditions for Rv2111c

Protein Domains

Gene Information
Locus	Rv2111c
Symbol
Gene Name	conserved hypothetical protein
Location	2370598 - 2370792 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:195 bp Protein:65 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	661
Related Genes	Acel_1187 CE1624 cg1689 DIP1246 jk0946 MAP1836c MAV_2403 Mkms_3192 ML1321 MSMEG_3896 MT2171 MUL_2332 Mvan_3450 nfa31730 SAV6679
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv2111c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv2111c Transcript 1
MAQEQTKRGGGGGDDDDIAGSTAAGQERREKLTEETDDLLDEIDDVLEENAEDFVRAYVQ
KGGQ*

Genomic Sequence

>Rv2111c
ATGGCGCAAGAGCAGACCAAGCGTGGCGGTGGCGGCGGCGATGATGACGACATCGCCGGC
AGCACCGCCGCGGGCCAGGAGCGTCGCGAAAAGCTGACCGAGGAGACCGACGATCTGCTC
GACGAAATCGACGACGTCCTCGAGGAGAACGCCGAGGACTTCGTCCGCGCATACGTCCAA
AAGGGCGGACAGTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Translation Rv2859c	active	akvsangli	2012-10-05
	Affinity purification (Physical interaction) RA. Festa,F. McAllister,MJ. Pearce,J. Mintseris,KE. Burns,SP. Gygi,KH. Darwin Prokayrotic ubiquitin-like protein (Pup) proteome of Mycobacterium tuberculosis. PLoS ONE 2010
Interaction	Regulatory Rv2115c	active	sourish10	2012-10-05
	Structural Analysis authors,DM. Ritchie,JN. Sierchio,RJ. Capetola,ME. Rosenthale SRS-A mediated bronchospasm by pharmacologic modification of lung anaphylaxis in vivo. Agents Actions 1981
Interaction	Regulatory Rv2115c	active	sourish10	2012-10-05
	Structural Analysis KH. Darwin, S. Ehrt et al. The proteasome of Mycobacterium tuberculosis is required for resistance to nitric oxide. Science 2003
Interaction	Regulatory Rv2115c	active	sourish10	2012-10-05
	Structural Analysis KH. Darwin, G. Lin et al. Characterization of a Mycobacterium tuberculosis proteasomal ATPase homologue. Mol. Microbiol. 2005
Interaction	Regulatory Rv2115c	active	sourish10	2012-10-05
	Structural Analysis M. Sutter,F. Striebel,FF. Damberger,FH. Allain,E. Weber-Ban A distinct structural region of the prokaryotic ubiquitin-like protein (Pup) is recognized by the N-terminal domain of the proteasomal ATPase Mpa. FEBS Lett. 2009
Interaction	Regulatory Rv2115c	active	sourish10	2012-10-05
	Spectrophotometric Analysis authors,DM. Ritchie,JN. Sierchio,RJ. Capetola,ME. Rosenthale SRS-A mediated bronchospasm by pharmacologic modification of lung anaphylaxis in vivo. Agents Actions 1981
Interaction	Regulatory Rv2115c	active	sourish10	2012-10-05
	Spectrophotometric Analysis KH. Darwin, S. Ehrt et al. The proteasome of Mycobacterium tuberculosis is required for resistance to nitric oxide. Science 2003
Interaction	Regulatory Rv2115c	active	sourish10	2012-10-05
	Spectrophotometric Analysis KH. Darwin, G. Lin et al. Characterization of a Mycobacterium tuberculosis proteasomal ATPase homologue. Mol. Microbiol. 2005
Interaction	Regulatory Rv2115c	active	sourish10	2012-10-05
	Spectrophotometric Analysis M. Sutter,F. Striebel,FF. Damberger,FH. Allain,E. Weber-Ban A distinct structural region of the prokaryotic ubiquitin-like protein (Pup) is recognized by the N-terminal domain of the proteasomal ATPase Mpa. FEBS Lett. 2009
Interaction	Regulatory Rv2115c	active	ahal4789	2012-10-05
	Structural Analysis authors,DM. Ritchie,JN. Sierchio,RJ. Capetola,ME. Rosenthale SRS-A mediated bronchospasm by pharmacologic modification of lung anaphylaxis in vivo. Agents Actions 1981
Interaction	Regulatory Rv2115c	active	ahal4789	2012-10-05
	Structural Analysis KH. Darwin, S. Ehrt et al. The proteasome of Mycobacterium tuberculosis is required for resistance to nitric oxide. Science 2003
Interaction	Regulatory Rv2115c	active	ahal4789	2012-10-05
	Structural Analysis KH. Darwin, G. Lin et al. Characterization of a Mycobacterium tuberculosis proteasomal ATPase homologue. Mol. Microbiol. 2005
Interaction	Regulatory Rv2115c	active	ahal4789	2012-10-05
	Structural Analysis M. Sutter,F. Striebel,FF. Damberger,FH. Allain,E. Weber-Ban A distinct structural region of the prokaryotic ubiquitin-like protein (Pup) is recognized by the N-terminal domain of the proteasomal ATPase Mpa. FEBS Lett. 2009
Interaction	Regulatory Rv2115c	active	ahal4789	2012-10-05
	Spectrophotometric Analysis authors,DM. Ritchie,JN. Sierchio,RJ. Capetola,ME. Rosenthale SRS-A mediated bronchospasm by pharmacologic modification of lung anaphylaxis in vivo. Agents Actions 1981
Interaction	Regulatory Rv2115c	active	ahal4789	2012-10-05
	Spectrophotometric Analysis KH. Darwin, S. Ehrt et al. The proteasome of Mycobacterium tuberculosis is required for resistance to nitric oxide. Science 2003
Interaction	Regulatory Rv2115c	active	ahal4789	2012-10-05
	Spectrophotometric Analysis KH. Darwin, G. Lin et al. Characterization of a Mycobacterium tuberculosis proteasomal ATPase homologue. Mol. Microbiol. 2005
Interaction	Regulatory Rv2115c	active	ahal4789	2012-10-05
	Spectrophotometric Analysis M. Sutter,F. Striebel,FF. Damberger,FH. Allain,E. Weber-Ban A distinct structural region of the prokaryotic ubiquitin-like protein (Pup) is recognized by the N-terminal domain of the proteasomal ATPase Mpa. FEBS Lett. 2009
Interaction	Regulatory Rv2710	active	priyadarshinipriyanka2001	2012-10-05
	Co-expression (Functional linkage) JH. Lee, PC. Karakousis et al. Roles of SigB and SigF in the Mycobacterium tuberculosis sigma factor network. J. Bacteriol. 2008
Interaction	Activation Rv2097c	active	priyadarshinipriyanka2001	2012-10-05
	Affinity purification (Physical interaction) MJ. Pearce, J. Mintseris et al. Ubiquitin-like protein involved in the proteasome pathway of Mycobacterium tuberculosis. Science 2008
Interaction	Activation Rv2097c	active	priyadarshinipriyanka2001	2012-10-05
	Affinity purification (Physical interaction) F. Striebel, F. Imkamp et al. Bacterial ubiquitin-like modifier Pup is deamidated and conjugated to substrates by distinct but homologous enzymes. Nat. Struct. Mol. Biol. 2009
Interaction	Activation Rv2097c	active	priyadarshinipriyanka2001	2012-10-05
	Affinity purification (Physical interaction) F. Imkamp,T. Rosenberger,F. Striebel,PM. Keller,B. Amstutz,P. Sander,E. Weber-Ban Deletion of dop in Mycobacterium smegmatis abolishes pupylation of protein substrates in vivo. Mol. Microbiol. 2010
Interaction	PhysicalInteraction Rv2243	active	priyadarshinipriyanka2001	2012-10-05
	Affinity purification (Physical interaction) MJ. Pearce, J. Mintseris et al. Ubiquitin-like protein involved in the proteasome pathway of Mycobacterium tuberculosis. Science 2008
Interaction	RegulatedBy Rv1221	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. R. Manganelli, MI. Voskuil et al. The Mycobacterium tuberculosis ECF sigma factor sigmaE: role in global gene expression and survival in macrophages. Mol. Microbiol. 2001