Rv2122c - phosphoribosyl-AMP pyrophosphatase hisE

Expression: Most Significant Conditions for Rv2122c

Protein Domains

Gene Information
Locus	Rv2122c
Symbol	hisE
Gene Name	phosphoribosyl-AMP pyrophosphatase hisE
Location	2380663 - 2380944 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:282 bp Protein:94 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	35624
Related Genes	Acel_1175 CE1635 CE1636 cg1699 cg1700 DIP1257 DIP1258 jk0953 MAP1847c MAV_2392 Mkms_3208 Mkms_3210 ML1309 Mmcs_3146 Mmcs_3148 MSMEG_4181 MSMEG_4183 MT2182 MUL_2353 Mvan_3471 Mvan_3473 nfa31860 nfa31900 SAV6668
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv2122c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv2122c Transcript 1
MQQSLAVKTFEDLFAELGDRARTRPADSTTVAALDGGVHALGKKLLEEAGEVWLAAEHES
NDALAEEISQLLYWTQVLMISRGLSLDDVYRKL*

Genomic Sequence

>Rv2122c
GTGCAACAATCGCTGGCCGTGAAGACCTTCGAGGATCTGTTCGCCGAACTCGGCGATCGT
GCCCGCACCCGGCCGGCCGACAGCACCACGGTGGCGGCATTGGACGGCGGGGTTCATGCT
CTGGGTAAGAAGCTTCTCGAGGAGGCCGGCGAGGTGTGGCTGGCTGCCGAGCACGAATCC
AACGACGCACTGGCGGAGGAGATCAGCCAGTTGCTGTACTGGACGCAGGTGCTGATGATC
TCCCGTGGACTGTCCCTCGACGACGTCTATCGAAAGCTGTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Regulatory Rv2123	active	sourish10	2012-10-05
	Footprinting GM. Rodriguez, MI. Voskuil et al. ideR, An essential gene in mycobacterium tuberculosis: role of IdeR in iron-dependent gene expression, iron metabolism, and oxidative stress response. Infect. Immun. 2002
Interaction	Regulatory Rv2123	active	sourish10	2012-10-05
	Footprinting P. Prakash, S. Yellaboina et al. Computational prediction and experimental verification of novel IdeR binding sites in the upstream sequences of Mycobacterium tuberculosis open reading frames. Bioinformatics 2005
Interaction	Regulatory Rv2123	active	ahal4789	2012-10-05
	Footprinting GM. Rodriguez, MI. Voskuil et al. ideR, An essential gene in mycobacterium tuberculosis: role of IdeR in iron-dependent gene expression, iron metabolism, and oxidative stress response. Infect. Immun. 2002
Interaction	Regulatory Rv2123	active	ahal4789	2012-10-05
	Footprinting P. Prakash, S. Yellaboina et al. Computational prediction and experimental verification of novel IdeR binding sites in the upstream sequences of Mycobacterium tuberculosis open reading frames. Bioinformatics 2005
Interaction	Operon Rv2121c	active	ashwinigbhat	2012-10-05
	operon GM. Rodriguez, B. Gold et al. Identification and characterization of two divergently transcribed iron regulated genes in Mycobacterium tuberculosis. Tuber. Lung Dis. 1999
Interaction	Operon Rv2121c	active	ashwinigbhat	2012-10-05
	operon F. Javid-Majd, D. Yang et al. The 1.25 A resolution structure of phosphoribosyl-ATP pyrophosphohydrolase from Mycobacterium tuberculosis. Acta Crystallogr. D Biol. Crystallogr. 2008
Interaction	Operon Rv2121c	active	priti.priety	2012-10-05
	operon GM. Rodriguez, B. Gold et al. Identification and characterization of two divergently transcribed iron regulated genes in Mycobacterium tuberculosis. Tuber. Lung Dis. 1999
Interaction	Operon Rv2121c	active	priti.priety	2012-10-05
	operon F. Javid-Majd, D. Yang et al. The 1.25 A resolution structure of phosphoribosyl-ATP pyrophosphohydrolase from Mycobacterium tuberculosis. Acta Crystallogr. D Biol. Crystallogr. 2008
Interaction	Operon Rv2121c	active	ashwinigbhat	2012-10-05
	operon GM. Rodriguez, B. Gold et al. Identification and characterization of two divergently transcribed iron regulated genes in Mycobacterium tuberculosis. Tuber. Lung Dis. 1999
Interaction	Operon Rv2121c	active	ashwinigbhat	2012-10-05
	operon F. Javid-Majd, D. Yang et al. The 1.25 A resolution structure of phosphoribosyl-ATP pyrophosphohydrolase from Mycobacterium tuberculosis. Acta Crystallogr. D Biol. Crystallogr. 2008
Interaction	Operon Rv2121c	active	priti.priety	2012-10-05
	operon GM. Rodriguez, B. Gold et al. Identification and characterization of two divergently transcribed iron regulated genes in Mycobacterium tuberculosis. Tuber. Lung Dis. 1999
Interaction	Operon Rv2121c	active	priti.priety	2012-10-05
	operon F. Javid-Majd, D. Yang et al. The 1.25 A resolution structure of phosphoribosyl-ATP pyrophosphohydrolase from Mycobacterium tuberculosis. Acta Crystallogr. D Biol. Crystallogr. 2008
Interaction	RegulatedBy Rv2711	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008