Rv2142c - hypothetical protein

Expression: Most Significant Conditions for Rv2142c

Protein Domains

Gene Information
Locus	Rv2142c
Symbol
Gene Name	hypothetical protein
Location	2402193 - 2402510 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:318 bp Protein:106 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	9071
Related Genes	MT2200
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv2142c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv2142c Transcript 1
MTRRLRVHNGVEDDLFEAFSYYADAAPDQIDRLYNLFVDAVTKRIPQAPNAFAPLFKHYR
HIYLRPFRYYVAYRTTDEAIDILAVRHGMENPNAVEAEISGRTFE*

Genomic Sequence

>Rv2142c
ATGACGCGCAGGCTGCGCGTCCATAACGGGGTTGAAGACGACCTATTCGAGGCGTTTTCC
TACTACGCGGACGCGGCGCCAGATCAGATCGATCGGCTTTACAACTTGTTTGTCGATGCC
GTGACGAAGCGGATTCCGCAGGCTCCGAACGCGTTTGCGCCGTTATTCAAGCACTATCGA
CACATCTACCTCCGGCCCTTCAGGTACTACGTTGCCTATCGGACGACCGACGAGGCTATC
GACATACTGGCTGTTCGGCACGGAATGGAGAACCCGAACGCGGTCGAGGCTGAGATCTCT
GGCCGCACCTTCGAGTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Inhibits Rv1960c	active	harsharohiratruefriend	2012-10-05
	operon(Functional linkage) authors,K. Simola,RK. Selander,A. de la Chapelle,G. Corneo,E. Ginelli Molecular basis of chromosome banding. I. The effect of mouse DNA fractions on two fluorescent dyes in vitro. Chromosoma 1975
Interaction	Inhibits Rv1960c	active	harsharohiratruefriend	2012-10-05
	operon(Functional linkage) authors,K. Gerdes,SK. Christensen,A. Løbner-Olesen Prokaryotic toxin-antitoxin stress response loci. Nat. Rev. Microbiol. 2005
Interaction	Inhibits Rv1960c	active	harsharohiratruefriend	2012-10-05
	operon(Functional linkage) authors,V. Anantharaman,L. Aravind New connections in the prokaryotic toxin-antitoxin network: relationship with the eukaryotic nonsense-mediated RNA decay system. Genome Biol. 2003
Interaction	Inhibits Rv1960c	active	harsharohiratruefriend	2012-10-05
	operon(Functional linkage) authors,KM. Dalton,S. Crosson A conserved mode of protein recognition and binding in a ParD-ParE toxin-antitoxin complex. Biochemistry 2010
Symbol	ParE2	active	jlew	2012-03-07
	Toxic to Ecoli growth. We report the heterologous toxicity of these TA loci in Escherichia coli and show that only a few of the M. tuberculosis-encoded toxins can inhibit E. coli growth and have a killing effect. This killing effect can be suppressed by coexpression of the cognate antitoxin. authors,A. Gupta Killing activity and rescue function of genome-wide toxin-antitoxin loci of Mycobacterium tuberculosis. FEMS Microbiol. Lett. 2009
Other	strand:+	active	rslayden	2012-03-05
	Hypothetical unknown protein
Other	stop:2402510	active	rslayden	2012-03-05
	Hypothetical unknown protein
Other	start:2402193	active	rslayden	2012-03-05
	Hypothetical unknown protein