Rv2175c - conserved hypothetical protein

Expression: Most Significant Conditions for Rv2175c

Protein Domains

Gene Information
Locus	Rv2175c
Symbol
Gene Name	conserved hypothetical protein
Location	2437446 - 2437886 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:441 bp Protein:147 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	843
Related Genes	CE2069 cg2386 DIP1614 MAP1913c MAV_2320 Mkms_3333 ML0898 Mmcs_3271 MSMEG_4242 MT2231 MUL_3518 Mvan_3538 nfa17340 SAV6098
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv2175c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv2175c Transcript 1
MPGRAPGSTLARVGSIPAGDDVLDPDEPTYDLPRVAELLGVPVSKVAQQLREGHLVAVRR
AGGVVIPQVFFTNSGQVVKSLPGLLTILHDGGYRDTEIMRWLFTPDPSLTITRDGSRDAV
SNARPVDALHAHQAREVVRRAQAMAY*

Genomic Sequence

>Rv2175c
ATGCCTGGCCGCGCACCAGGCTCTACACTTGCGCGGGTGGGCAGCATTCCCGCTGGCGAT
GACGTTTTGGACCCTGACGAACCGACGTACGACCTGCCCCGGGTCGCCGAGCTGCTCGGC
GTTCCGGTCAGCAAGGTGGCCCAGCAGCTGCGGGAAGGTCATCTGGTGGCCGTGCGGCGC
GCTGGTGGCGTGGTGATCCCTCAGGTCTTCTTCACCAACTCCGGTCAGGTGGTCAAGAGC
CTGCCGGGGCTGTTGACCATCCTGCACGACGGGGGCTATCGCGACACCGAGATTATGCGC
TGGCTGTTTACCCCCGATCCGTCGCTGACCATCACCCGCGACGGCTCGCGTGACGCCGTC
AGCAACGCCCGTCCCGTCGATGCATTGCATGCCCACCAGGCTCGCGAGGTGGTGCGCCGG
GCCCAGGCTATGGCGTATTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Regulates Rv3552	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulates Rv3551	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulates Rv3550	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	Regulates Rv0469	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009