Rv2274c - hypothetical protein

Expression: Most Significant Conditions for Rv2274c

Protein Domains

Gene Information
Locus	Rv2274c
Symbol
Gene Name	hypothetical protein
Location	2546488 - 2546805 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:318 bp Protein:106 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	9083
Related Genes
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv2274c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv2274c Transcript 1
MSIARSAQPIGWISCPPKGGSSCCRCGGGYTHIFCVSAWTGLVVDLQAEQVRSVVTERLR
RRIGRGAPILAGTLAPGVGLAAQNREFRQFTGRSAPPSATIAFGE*

Genomic Sequence

>Rv2274c
ATGTCTATCGCCCGATCGGCCCAGCCTATTGGGTGGATCTCGTGTCCACCAAAAGGGGGA
TCCAGCTGCTGCCGCTGTGGCGGCGGGTACACTCACATATTTTGCGTATCAGCCTGGACC
GGTCTTGTGGTTGACTTGCAGGCTGAGCAGGTCAGATCCGTTGTGACCGAACGGCTGCGC
CGGCGGATCGGCCGAGGCGCTCCTATCCTCGCAGGCACGCTGGCTCCCGGCGTTGGTCTA
GCCGCACAAAATCGTGAATTCCGGCAATTTACAGGAAGGTCCGCGCCGCCATCGGCCACG
ATCGCATTTGGCGAGTAG

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Regulatory Rv0616c	active	akankshajain.21	2012-10-05
	Co-expression (Functional linkage) T. Parish, DA. Smith et al. The senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. Microbiology (Reading, Engl.) 2003
Interaction	RegulatedBy Rv0491	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. T. Parish, DA. Smith et al. The senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. Microbiology (Reading, Engl.) 2003
Symbol	MazF8	active	jlew	2012-03-07
	We report the heterologous toxicity of these TA loci in Escherichia coli and show that only a few of the M. tuberculosis-encoded toxins can inhibit E. coli growth and have a killing effect. This killing effect can be suppressed by coexpression of the cognate antitoxin. authors,A. Gupta Killing activity and rescue function of genome-wide toxin-antitoxin loci of Mycobacterium tuberculosis. FEMS Microbiol. Lett. 2009
Other	strand:+	active	rslayden	2012-03-05
	Unknown protein; questionable ORF.
Other	stop:2546805	active	rslayden	2012-03-05
	Unknown protein; questionable ORF.
Other	start:2546488	active	rslayden	2012-03-05
	Unknown protein; questionable ORF.