Rv2342 - conserved hypothetical protein

Expression: Most Significant Conditions for Rv2342

Protein Domains

Gene Information
Locus	Rv2342
Symbol
Gene Name	conserved hypothetical protein
Location	2620272 - 2620529 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:258 bp Protein:86 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	879
Related Genes	CE2168 cg2488 DIP1697 jk0635 MAP2129 MAV_2044 Mkms_3503 ML0834 Mmcs_3440 MSMEG_4479 MT2407 MUL_1460 Mvan_3812 nfa14710
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv2342
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv2342 Transcript 1
MIGYVAVLGLGYVLGAKAGRRRYEQIASTYRALTGSPVARSMIEGGRRKIANRISPDAGF
VTLAEIDNQTAVVQRGVERQPKTAR*

Genomic Sequence

>Rv2342
TTGATCGGGTATGTCGCCGTGTTGGGACTGGGTTACGTGCTGGGCGCAAAAGCCGGGCGC
CGCCGCTACGAGCAGATCGCGAGCACCTATCGCGCACTCACCGGCAGCCCCGTGGCCAGG
TCGATGATCGAAGGCGGGCGTCGCAAGATCGCCAATCGGATCTCACCCGATGCTGGGTTT
GTGACCCTGGCCGAGATCGACAACCAGACCGCCGTTGTCCAGCGCGGGGTCGAGCGGCAG
CCGAAAACCGCGCGCTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Transcription Rv3676	active	jgalag	2012-10-05
	Band shift M. Stapleton, I. Haq et al. Mycobacterium tuberculosis cAMP receptor protein (Rv3676) differs from the Escherichia coli paradigm in its cAMP binding and DNA binding properties and transcription activation properties. J. Biol. Chem. 2010
Interaction	Transcription Rv3676	active	jgalag	2012-10-05
	Band shift G. Bai, LA. McCue et al. Characterization of Mycobacterium tuberculosis Rv3676 (CRPMt), a cyclic AMP receptor protein-like DNA binding protein. J. Bacteriol. 2005
Interaction	Transcription Rv3676	active	sourish10	2012-10-05
	Affinity purification (Physical interaction) G. Bai, LA. McCue et al. Characterization of Mycobacterium tuberculosis Rv3676 (CRPMt), a cyclic AMP receptor protein-like DNA binding protein. J. Bacteriol. 2005
Interaction	RegulatedBy Rv3676	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008