Rv2358 - transcriptional regulator, arsR-family

Expression: Most Significant Conditions for Rv2358

Protein Domains

Gene Information
Locus	Rv2358
Symbol
Gene Name	transcriptional regulator, arsR-family
Location	2641246 - 2641653 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:408 bp Protein:136 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	31721
Related Genes	CE2179 cg2500 DIP1709 MAP2138 MAV_2037 Mkms_3509 ML0825 Mmcs_3446 MSMEG_4486 MT2427 MUL_3611 Mvan_3819 nfa14580
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv2358
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv2358 Transcript 1
MVTSPSTPTAAHEDVGADEVGGHQHPADRFAECPTFPAPPPREILDAAGELLRALAAPVR
IAIVLQLRESQRCVHELVDALHVPQPLVSQHLKILKAAGVVTGERSGREVLYRLADHHLA
HIVLDAVAHAGEDAI*

Genomic Sequence

>Rv2358
ATGGTGACGTCCCCCTCAACGCCGACCGCCGCCCACGAAGATGTGGGTGCCGACGAAGTA
GGCGGTCACCAGCATCCCGCGGATAGGTTCGCCGAATGCCCCACGTTCCCCGCACCACCG
CCGCGGGAGATCCTAGACGCTGCCGGCGAGCTGCTGCGTGCGCTGGCCGCACCGGTGCGG
ATCGCCATCGTGCTGCAATTGCGTGAATCTCAACGCTGCGTGCACGAACTGGTCGACGCA
CTGCACGTGCCCCAGCCGTTGGTCAGCCAACATCTGAAGATCCTCAAGGCGGCGGGCGTG
GTCACCGGGGAGCGATCGGGCCGAGAAGTGCTGTACCGACTTGCTGACCACCACCTCGCG
CACATTGTGCTCGACGCCGTCGCGCACGCCGGTGAGGACGCAATATGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Transcription Rv2359	active	jhum4u2006	2012-10-05
	Affinity purification (Physical interaction) F. Canneva, M. Branzoni et al. Rv2358 and FurB: two transcriptional regulators from Mycobacterium tuberculosis which respond to zinc. J. Bacteriol. 2005
Interaction	Transcription Rv2358	active	jhum4u2006	2012-10-05
	Affinity purification (Physical interaction) F. Canneva, M. Branzoni et al. Rv2358 and FurB: two transcriptional regulators from Mycobacterium tuberculosis which respond to zinc. J. Bacteriol. 2005
Interaction	Transcription Rv2358	active	jhum4u2006	2012-10-05
	Affinity purification (Physical interaction) F. Canneva, M. Branzoni et al. Rv2358 and FurB: two transcriptional regulators from Mycobacterium tuberculosis which respond to zinc. J. Bacteriol. 2005
Interaction	Transcription Rv2359	active	jhum4u2006	2012-10-05
	Affinity purification (Physical interaction) F. Canneva, M. Branzoni et al. Rv2358 and FurB: two transcriptional regulators from Mycobacterium tuberculosis which respond to zinc. J. Bacteriol. 2005
Interaction	Regulates Rv2359	active	yamir.moreno	2012-10-05
	Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . LacZ-promoter fusion. expression levels of LacZ- regulated promoter fusion measured and compared between wild-type and trans-element mutation (knockout, over expression etc.). F. Canneva, M. Branzoni et al. Rv2358 and FurB: two transcriptional regulators from Mycobacterium tuberculosis which respond to zinc. J. Bacteriol. 2005
Interaction	Regulates Rv2359	active	yamir.moreno	2012-10-05
	Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . LacZ-promoter fusion. expression levels of LacZ- regulated promoter fusion measured and compared between wild-type and trans-element mutation (knockout, over expression etc.). F. Canneva, M. Branzoni et al. Rv2358 and FurB: two transcriptional regulators from Mycobacterium tuberculosis which respond to zinc. J. Bacteriol. 2005
Interaction	RegulatedBy Rv2358	active	yamir.moreno	2012-10-05
	Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . LacZ-promoter fusion. expression levels of LacZ- regulated promoter fusion measured and compared between wild-type and trans-element mutation (knockout, over expression etc.). F. Canneva, M. Branzoni et al. Rv2358 and FurB: two transcriptional regulators from Mycobacterium tuberculosis which respond to zinc. J. Bacteriol. 2005
Interaction	Regulates Rv2358	active	yamir.moreno	2012-10-05
	Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . LacZ-promoter fusion. expression levels of LacZ- regulated promoter fusion measured and compared between wild-type and trans-element mutation (knockout, over expression etc.). F. Canneva, M. Branzoni et al. Rv2358 and FurB: two transcriptional regulators from Mycobacterium tuberculosis which respond to zinc. J. Bacteriol. 2005
Interaction	RegulatedBy Rv2358	active	yamir.moreno	2012-10-05
	Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . LacZ-promoter fusion. expression levels of LacZ- regulated promoter fusion measured and compared between wild-type and trans-element mutation (knockout, over expression etc.). F. Canneva, M. Branzoni et al. Rv2358 and FurB: two transcriptional regulators from Mycobacterium tuberculosis which respond to zinc. J. Bacteriol. 2005
Interaction	Regulates Rv2358	active	yamir.moreno	2012-10-05
	Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . LacZ-promoter fusion. expression levels of LacZ- regulated promoter fusion measured and compared between wild-type and trans-element mutation (knockout, over expression etc.). F. Canneva, M. Branzoni et al. Rv2358 and FurB: two transcriptional regulators from Mycobacterium tuberculosis which respond to zinc. J. Bacteriol. 2005
Interaction	Regulates Rv2359	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	RegulatedBy Rv2358	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Regulates Rv2358	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	Transcription Rv2359	active	jhum4u2006	2012-10-03
	Affinity purification (Physical interaction) F. Canneva, M. Branzoni et al. Rv2358 and FurB: two transcriptional regulators from Mycobacterium tuberculosis which respond to zinc. J. Bacteriol. 2005
Interaction	Transcription Rv2358	active	jhum4u2006	2012-10-03
	Affinity purification (Physical interaction) F. Canneva, M. Branzoni et al. Rv2358 and FurB: two transcriptional regulators from Mycobacterium tuberculosis which respond to zinc. J. Bacteriol. 2005
Interaction	Transcription Rv2358	active	jhum4u2006	2012-10-03
	Affinity purification (Physical interaction) F. Canneva, M. Branzoni et al. Rv2358 and FurB: two transcriptional regulators from Mycobacterium tuberculosis which respond to zinc. J. Bacteriol. 2005
Interaction	Transcription Rv2359	active	jhum4u2006	2012-10-03
	Affinity purification (Physical interaction) F. Canneva, M. Branzoni et al. Rv2358 and FurB: two transcriptional regulators from Mycobacterium tuberculosis which respond to zinc. J. Bacteriol. 2005