Rv2384 - bifunctional salicyl-AMP ligase/salicyl-S-arcp synthetase mbtA

Expression: Most Significant Conditions for Rv2384

Protein Domains

Gene Information
Locus	Rv2384
Symbol	mbtA
Gene Name	bifunctional salicyl-AMP ligase/salicyl-S-arcp synthetase mbtA
Location	2675936 - 2677633 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:1698 bp Protein:566 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	31132
Related Genes	MAP2178 MAV_2008 Mkms_3534 Mmcs_3471 MSMEG_4516 MT2452 MUL_3641 Mvan_3850 nfa6200
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv2384
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv2384 Transcript 1
MPPKAADGRRPSPDGGLGGFVPFPADRAASYRAAGYWSGRTLDTVLSDAARRWPDRLAVA
DAGDRPGHGGLSYAELDQRADRAAAALHGLGITPGDRVLLQLPNGCQFAVALFALLRAGA
IPVMCLPGHRAAELGHFAAVSAATGLVVADVASGFDYRPMARELVADHPTLRHVIVDGDP
GPFVSWAQLCAQAGTGSPAPPADPGSPALLLVSGGTTGMPKLIPRTHDDYVFNATASAAL
CRLSADDVYLVVLAAGHNFPLACPGLLGAMTVGATAVFAPDPSPEAAFAAIERHGVTVTA
LVPALAKLWAQSCEWEPVTPKSLRLLQVGGSKLEPEDARRVRTALTPGLQQVFGMAEGLL
NFTRIGDPPEVVEHTQGRPLCPADELRIVNADGEPVGPGEEGELLVRGPYTLNGYFAAER
DNERCFDPDGFYRSGDLVRRRDDGNLVVTGRVKDVICRAGETIAASDLEEQLLSHPAIFS
AAAVGLPDQYLGEKICAAVVFAGAPITLAELNGYLDRRGVAAHTRPDQLVAMPALPTTPI
GKIDKRAIVRQLGIATGPVTTQRCH*

Genomic Sequence

>Rv2384
ATGCCACCGAAGGCGGCAGATGGCCGCCGACCCAGTCCCGACGGCGGACTGGGTGGCTTT
GTACCGTTCCCCGCGGATCGGGCCGCGTCGTACCGGGCGGCCGGCTATTGGTCGGGGCGA
ACCCTGGACACCGTGCTCTCCGATGCCGCGCGGCGCTGGCCTGACCGCCTCGCGGTGGCC
GACGCCGGTGATCGTCCCGGCCACGGCGGCCTCAGTTACGCCGAACTCGACCAGCGGGCC
GACCGGGCCGCCGCGGCGCTGCACGGCCTGGGCATCACGCCAGGCGACCGGGTACTGCTC
CAGCTGCCAAACGGCTGCCAGTTCGCGGTTGCCCTGTTCGCGTTATTGCGGGCGGGAGCG
ATCCCAGTGATGTGCCTGCCCGGTCACCGCGCCGCCGAATTGGGCCACTTCGCCGCCGTC
AGCGCGGCCACCGGGCTGGTGGTCGCCGATGTGGCCAGCGGGTTCGACTATCGGCCGATG
GCGCGCGAACTTGTTGCCGATCACCCCACCCTGCGCCATGTCATCGTCGATGGCGATCCG
GGACCGTTCGTGTCGTGGGCGCAGCTGTGCGCCCAGGCCGGCACCGGTTCGCCGGCACCG
CCGGCCGATCCCGGATCGCCAGCGCTGCTGCTGGTCTCCGGCGGCACCACTGGCATGCCC
AAACTCATTCCACGCACCCACGACGACTACGTGTTCAACGCGACGGCCAGCGCCGCACTC
TGTCGGCTTAGCGCCGACGACGTCTATCTGGTGGTGCTGGCCGCCGGCCACAATTTCCCG
CTGGCCTGCCCGGGCCTGCTCGGCGCGATGACCGTCGGGGCCACCGCCGTGTTCGCCCCC
GATCCCAGCCCGGAGGCCGCCTTCGCCGCCATCGAGCGCCACGGTGTCACCGTCACCGCG
TTGGTTCCGGCACTGGCCAAACTGTGGGCCCAATCCTGTGAGTGGGAGCCGGTGACACCG
AAGTCACTGCGGTTGTTGCAGGTTGGCGGGTCCAAGCTAGAACCCGAGGACGCTCGCCGG
GTACGCACCGCGCTCACCCCGGGCCTGCAGCAGGTGTTCGGCATGGCGGAGGGGCTGCTG
AACTTCACCCGCATCGGCGACCCACCCGAAGTGGTGGAGCACACCCAGGGGCGGCCACTA
TGCCCGGCCGACGAACTGCGCATCGTCAACGCCGATGGTGAGCCGGTGGGGCCCGGGGAG
GAAGGCGAACTCTTGGTGCGCGGGCCCTACACGCTGAACGGCTATTTTGCTGCCGAACGC
GACAACGAGCGCTGCTTCGATCCGGACGGCTTCTACCGCAGCGGCGACCTGGTCCGCCGC
CGCGACGACGGCAATCTGGTGGTCACCGGGCGCGTCAAGGATGTCATCTGCCGTGCGGGA
GAAACCATCGCCGCCAGCGACCTCGAAGAACAGCTGCTGAGCCATCCGGCGATCTTCTCG
GCCGCGGCGGTGGGACTACCTGACCAGTATCTGGGGGAAAAAATCTGCGCTGCAGTCGTT
TTCGCTGGAGCTCCGATTACGCTTGCGGAGTTGAACGGCTACCTTGACCGGCGTGGTGTG
GCCGCGCATACGCGACCCGACCAGCTGGTCGCGATGCCGGCGCTGCCCACAACGCCGATC
GGGAAGATCGACAAACGAGCGATCGTCCGCCAGCTCGGCATCGCGACGGGTCCCGTGACG
ACCCAGCGCTGCCATTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Term	TBRXN:MCBTS3 carboxymycobactin synthesis - IDA	active	njamshidi	2012-10-05
	For carboxymycobactin see PMID: 7761471, also Cole et al text: Tuberculosis and the Tubercle Bacillus - R group length varies from 2-9 carbons - cmcbtt has 8C tail w/ last carbon fully oxidized to carboxyl group. Will add methyl ester form for current version. See PMID: 14670352. Mycobactin T is commonly found in Mtb authors,C. Ratledge Iron, mycobacteria and tuberculosis. Tuberculosis (Edinb) 2004
Term	EC:6.2.1.13 Acetate--CoA ligase (ADP-forming). - IDA	active	njamshidi	2012-10-05
	For carboxymycobactin see PMID: 7761471, also Cole et al text: Tuberculosis and the Tubercle Bacillus - R group length varies from 2-9 carbons - cmcbtt has 8C tail w/ last carbon fully oxidized to carboxyl group. Will add methyl ester form for current version. See PMID: 14670352. Mycobactin T is commonly found in Mtb authors,C. Ratledge Iron, mycobacteria and tuberculosis. Tuberculosis (Edinb) 2004
Term	TBRXN:MCBTS3 carboxymycobactin synthesis - IDA	active	njamshidi	2012-10-05
	For carboxymycobactin see PMID: 7761471, also Cole et al text: Tuberculosis and the Tubercle Bacillus - R group length varies from 2-9 carbons - cmcbtt has 8C tail w/ last carbon fully oxidized to carboxyl group. Will add methyl ester form for current version. See PMID: 14670352. Mycobactin T is commonly found in Mtb authors,J. Gobin,CH. Moore,JR. Reeve,DK. Wong,BW. Gibson,MA. Horwitz Iron acquisition by Mycobacterium tuberculosis: isolation and characterization of a family of iron-binding exochelins. Proc. Natl. Acad. Sci. U.S.A. 1995
Term	EC:6.2.1.13 Acetate--CoA ligase (ADP-forming). - IDA	active	njamshidi	2012-10-05
	For carboxymycobactin see PMID: 7761471, also Cole et al text: Tuberculosis and the Tubercle Bacillus - R group length varies from 2-9 carbons - cmcbtt has 8C tail w/ last carbon fully oxidized to carboxyl group. Will add methyl ester form for current version. See PMID: 14670352. Mycobactin T is commonly found in Mtb authors,J. Gobin,CH. Moore,JR. Reeve,DK. Wong,BW. Gibson,MA. Horwitz Iron acquisition by Mycobacterium tuberculosis: isolation and characterization of a family of iron-binding exochelins. Proc. Natl. Acad. Sci. U.S.A. 1995
Term	TBRXN:MCBTS2 mycobactin synthesis - IPI	active	njamshidi	2012-10-05
	See PMID: 14670352. Mycobactin T is commonly found in Mtb authors,C. Ratledge Iron, mycobacteria and tuberculosis. Tuberculosis (Edinb) 2004
Term	EC:6.2.1.13 Acetate--CoA ligase (ADP-forming). - IPI	active	njamshidi	2012-10-05
	See PMID: 14670352. Mycobactin T is commonly found in Mtb authors,C. Ratledge Iron, mycobacteria and tuberculosis. Tuberculosis (Edinb) 2004
Term	TBRXN:MCBTS2 mycobactin synthesis - ISS	active	njamshidi	2012-10-05
	See PMID: 14670352. Mycobactin T is commonly found in Mtb authors,C. Ratledge Iron, mycobacteria and tuberculosis. Tuberculosis (Edinb) 2004
Term	EC:6.2.1.13 Acetate--CoA ligase (ADP-forming). - ISS	active	njamshidi	2012-10-05
	See PMID: 14670352. Mycobactin T is commonly found in Mtb authors,C. Ratledge Iron, mycobacteria and tuberculosis. Tuberculosis (Edinb) 2004
Interaction	Regulatory Rv2711	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) authors,A. Gupte,M. Subramanian,RP. Remmel,CC. Aldrich Synthesis of deuterium-labelled 5'-O-[N-(Salicyl)sulfamoyl]adenosine (Sal-AMS-d(4)) as an internal standard for quantitation of Sal-AMS. J Labelled Comp Radiopharm 2008
Interaction	Regulatory Rv2711	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) GM. Rodriguez & I. Smith Mechanisms of iron regulation in mycobacteria: role in physiology and virulence. Mol. Microbiol. 2003
Interaction	Regulatory Rv2711	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) LE. Quadri, J. Sello et al. Identification of a Mycobacterium tuberculosis gene cluster encoding the biosynthetic enzymes for assembly of the virulence-conferring siderophore mycobactin. Chem. Biol. 1998
Interaction	Regulatory Rv2711	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) authors,JJ. De Voss,K. Rutter,BG. Schroeder,CE. Barry Iron acquisition and metabolism by mycobacteria. J. Bacteriol. 1999
Interaction	Regulatory Rv2711	active	shahanup86	2012-10-05
	Co-expression (Functional linkage) GM. Rodriguez, MI. Voskuil et al. ideR, An essential gene in mycobacterium tuberculosis: role of IdeR in iron-dependent gene expression, iron metabolism, and oxidative stress response. Infect. Immun. 2002
Interaction	RegulatedBy Rv2711	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	RegulatedBy Rv2359	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	RegulatedBy Rv2359	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. authors,M. Madan Babu,SA. Teichmann,L. Aravind Evolutionary dynamics of prokaryotic transcriptional regulatory networks. J. Mol. Biol. 2006
Term	EC:6.-.-.- Ligases. - NR	active	jjmcfadden	2012-03-05
	Inferred from direct assay authors,JJ. De Voss,K. Rutter,BG. Schroeder,CE. Barry Iron acquisition and metabolism by mycobacteria. J. Bacteriol. 1999