Rv2396 - PE-PGRS family protein

Expression: Most Significant Conditions for Rv2396

Protein Domains

Gene Information
Locus	Rv2396
Symbol	PE_PGRS41
Gene Name	PE-PGRS family protein
Location	2692799 - 2693884 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:1086 bp Protein:362 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	22538
Related Genes
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv2396
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv2396 Transcript 1
MSFLIASPEALAATATYLTGIGSAISAANAVAAAPTTEILAAGTDEVSTAISALFGAHAQ
AYQALSAHVAAFHDQFVHTLTAGAGSYMAAEAAAASPLQALQLELLNAINAPTLALLGRP
LIGDGTDAAPGSGGAGGAGGILIGNGGTGGASDLAGTGRGGVGGAGGAGGLFGIGGAGGG
CGSAVAIGGDGGAGGAGGVFSGGGAGGAGDAIGGSGGAGGTGGLLGGGGGAGGAGGAGGN
GGGASNSASIGGDGGSGGAGGMLYGAGGVGGNGGAAVAIGGDGGAGGRAGAIGNGGDGGN
GGTSNTPGGSGGDGGNGGNAGLIGNGGNGGNAEIVISGGSVAGTGGNGGLLLGFNGTNGL
P*

Genomic Sequence

>Rv2396
ATGTCGTTCCTGATTGCTTCGCCGGAGGCGCTAGCGGCGACAGCCACATATTTGACAGGT
ATCGGTTCGGCAATCAGCGCGGCGAACGCGGTCGCGGCCGCCCCGACAACAGAGATCCTG
GCGGCGGGGACCGACGAGGTGTCCACCGCCATCTCAGCGCTGTTCGGCGCTCATGCCCAG
GCATATCAGGCGCTCAGCGCCCACGTGGCGGCATTTCACGACCAGTTCGTGCATACCTTG
ACCGCCGGTGCCGGCTCATACATGGCCGCCGAGGCCGCCGCCGCCTCGCCTCTGCAGGCT
TTGCAGCTGGAGCTGCTCAACGCCATCAATGCACCCACCCTGGCGCTGTTGGGACGCCCG
TTGATCGGCGACGGCACCGATGCGGCGCCGGGGAGCGGGGGGGCCGGCGGGGCCGGCGGC
ATCTTGATCGGCAACGGCGGGACCGGCGGCGCCAGCGACTTAGCCGGGACCGGCCGCGGC
GGGGTCGGCGGGGCGGGCGGCGCCGGCGGGCTCTTCGGCATCGGCGGCGCCGGCGGGGGC
TGCGGGTCCGCGGTGGCGATCGGGGGTGACGGCGGGGCTGGTGGCGCCGGCGGCGTGTTC
AGCGGCGGCGGCGCCGGCGGGGCCGGCGACGCCATCGGGGGTAGCGGCGGCGCGGGCGGC
ACCGGTGGGCTGTTGGGTGGTGGCGGCGGCGCGGGCGGCGCCGGCGGCGCCGGCGGCAAT
GGCGGGGGCGCCAGCAACAGCGCAAGTATCGGGGGTGACGGTGGGTCCGGCGGCGCGGGC
GGCATGCTCTACGGTGCCGGCGGCGTCGGCGGCAACGGCGGGGCCGCGGTCGCTATCGGG
GGTGACGGCGGGGCCGGCGGCAGGGCCGGAGCGATCGGCAACGGCGGTGACGGCGGCAAC
GGCGGGACTTCCAACACCCCCGGCGGTAGCGGCGGCGACGGCGGCAATGGCGGGAACGCC
GGACTGATCGGCAACGGCGGTAACGGCGGCAACGCCGAGATTGTCATCTCCGGCGGTAGC
GTCGCCGGCACCGGTGGCAACGGCGGGTTGCTGTTGGGCTTCAACGGCACGAACGGGCTG
CCGTAG

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Transcription Rv3676	active	jgalag	2012-10-05
	Band shift M. Stapleton, I. Haq et al. Mycobacterium tuberculosis cAMP receptor protein (Rv3676) differs from the Escherichia coli paradigm in its cAMP binding and DNA binding properties and transcription activation properties. J. Biol. Chem. 2010
Interaction	Transcription Rv3676	active	jgalag	2012-10-05
	Band shift G. Bai, LA. McCue et al. Characterization of Mycobacterium tuberculosis Rv3676 (CRPMt), a cyclic AMP receptor protein-like DNA binding protein. J. Bacteriol. 2005
Interaction	Transcription Rv3676	active	sourish10	2012-10-05
	Affinity purification (Physical interaction) G. Bai, LA. McCue et al. Characterization of Mycobacterium tuberculosis Rv3676 (CRPMt), a cyclic AMP receptor protein-like DNA binding protein. J. Bacteriol. 2005
Interaction	Transcription Rv3414c	active	sourish10	2012-10-05
	Affinity purification (Physical interaction) G. Bai, LA. McCue et al. Characterization of Mycobacterium tuberculosis Rv3676 (CRPMt), a cyclic AMP receptor protein-like DNA binding protein. J. Bacteriol. 2005
Interaction	Transcription Rv0757	active	sourish10	2012-10-05
	Affinity purification (Physical interaction) G. Bai, LA. McCue et al. Characterization of Mycobacterium tuberculosis Rv3676 (CRPMt), a cyclic AMP receptor protein-like DNA binding protein. J. Bacteriol. 2005
Interaction	Transcription Rv3676	active	sourish10	2012-10-05
	Affinity purification (Physical interaction) SB. Walters, E. Dubnau et al. The Mycobacterium tuberculosis PhoPR two-component system regulates genes essential for virulence and complex lipid biosynthesis. Mol. Microbiol. 2006
Interaction	Transcription Rv3414c	active	sourish10	2012-10-05
	Affinity purification (Physical interaction) SB. Walters, E. Dubnau et al. The Mycobacterium tuberculosis PhoPR two-component system regulates genes essential for virulence and complex lipid biosynthesis. Mol. Microbiol. 2006
Interaction	Transcription Rv0757	active	sourish10	2012-10-05
	Affinity purification (Physical interaction) SB. Walters, E. Dubnau et al. The Mycobacterium tuberculosis PhoPR two-component system regulates genes essential for virulence and complex lipid biosynthesis. Mol. Microbiol. 2006
Interaction	Transcription Rv3676	active	sourish10	2012-10-05
	Affinity purification (Physical interaction) H. Calamita, C. Ko et al. The Mycobacterium tuberculosis SigD sigma factor controls the expression of ribosome-associated gene products in stationary phase and is required for full virulence. Cell. Microbiol. 2005
Interaction	Transcription Rv3414c	active	sourish10	2012-10-05
	Affinity purification (Physical interaction) H. Calamita, C. Ko et al. The Mycobacterium tuberculosis SigD sigma factor controls the expression of ribosome-associated gene products in stationary phase and is required for full virulence. Cell. Microbiol. 2005
Interaction	Transcription Rv0757	active	sourish10	2012-10-05
	Affinity purification (Physical interaction) H. Calamita, C. Ko et al. The Mycobacterium tuberculosis SigD sigma factor controls the expression of ribosome-associated gene products in stationary phase and is required for full virulence. Cell. Microbiol. 2005
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) ML. Chesne-Seck, N. Barilone et al. A point mutation in the two-component regulator PhoP-PhoR accounts for the absence of polyketide-derived acyltrehaloses but not that of phthiocerol dimycocerosates in Mycobacterium tuberculosis H37Ra. J. Bacteriol. 2008
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) authors,A. Sola-Landa,RS. Moura,JF. Martín The two-component PhoR-PhoP system controls both primary metabolism and secondary metabolite biosynthesis in Streptomyces lividans. Proc. Natl. Acad. Sci. U.S.A. 2003
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) J. Gonzalo Asensio, C. Maia et al. The virulence-associated two-component PhoP-PhoR system controls the biosynthesis of polyketide-derived lipids in Mycobacterium tuberculosis. J. Biol. Chem. 2006
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) J. Gonzalo-Asensio, CY. Soto et al. The Mycobacterium tuberculosis phoPR operon is positively autoregulated in the virulent strain H37Rv. J. Bacteriol. 2008
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) A. Sinha, S. Gupta et al. PhoP-PhoP interaction at adjacent PhoP binding sites is influenced by protein phosphorylation. J. Bacteriol. 2008
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) J. Gonzalo Asensio, C. Maia et al. The virulence-associated two-component PhoP-PhoR system controls the biosynthesis of polyketide-derived lipids in Mycobacterium tuberculosis. J. Biol. Chem. 2006
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) M. Ryndak, S. Wang et al. PhoP, a key player in Mycobacterium tuberculosis virulence. Trends Microbiol. 2008
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) JA. Asensio, A. Arbués et al. Live tuberculosis vaccines based on phoP mutants: a step towards clinical trials. Expert opinion on biological therapy 2008
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) SB. Walters, E. Dubnau et al. The Mycobacterium tuberculosis PhoPR two-component system regulates genes essential for virulence and complex lipid biosynthesis. Mol. Microbiol. 2006
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) J. Gonzalo-Asensio, S. Mostowy et al. PhoP: a missing piece in the intricate puzzle of Mycobacterium tuberculosis virulence. PLoS ONE 2008
Interaction	RegulatedBy Rv0981	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. H. He, R. Hovey et al. MprAB is a stress-responsive two-component system that directly regulates expression of sigma factors SigB and SigE in Mycobacterium tuberculosis. J. Bacteriol. 2006
Interaction	RegulatedBy Rv0757	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. J. Gonzalo Asensio, C. Maia et al. The virulence-associated two-component PhoP-PhoR system controls the biosynthesis of polyketide-derived lipids in Mycobacterium tuberculosis. J. Biol. Chem. 2006
Interaction	RegulatedBy Rv0757	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. SB. Walters, E. Dubnau et al. The Mycobacterium tuberculosis PhoPR two-component system regulates genes essential for virulence and complex lipid biosynthesis. Mol. Microbiol. 2006
Interaction	RegulatedBy Rv3676	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008