Rv2398c - sulfate-transport membrane protein ABC transporter cysW

Expression: Most Significant Conditions for Rv2398c

Protein Domains

Gene Information
Locus	Rv2398c
Symbol	cysW
Gene Name	sulfate-transport membrane protein ABC transporter cysW
Location	2694981 - 2695799 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:819 bp Protein:273 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	37921
Related Genes	MAP2211c MAV_1784 Mkms_3543 Mmcs_3480 MSMEG_4531 MT2469 MUL_3659 Mvan_3873 nfa14060
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv2398c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv2398c Transcript 1
MTSLPAARYLVRSVALGYVFVLLIVPVALILWRTFEPGFGQFYAWISTPAAISALNLSLL
VVAIVVPLNVIFGVTTALVLARNRFRGKGVLQAIIDLPFAVSPVIVGVSLILLWGSAGAL
GFVEQDLGFKIIFGLPGIVLGSMFVTCPFVVREVEPVLHELGTDQEQAAATLGSGWWQTF
WRITLPSIRWGLTYGIVLTVARTLGEYGAVIIVSSNLPGTSQTLTLLVSDRYHRGAEYGA
YALSTLLMAVSVVVLIVQMVLDARRARAVSEG*

Genomic Sequence

>Rv2398c
ATGACCTCCTTGCCGGCGGCTCGCTACCTCGTCCGATCGGTCGCGCTGGGGTACGTCTTT
GTGCTGTTGATCGTTCCGGTAGCGCTGATCCTGTGGCGGACCTTCGAACCGGGCTTTGGC
CAGTTCTACGCCTGGATCAGTACCCCGGCGGCGATATCAGCGCTGAACCTGTCGCTACTG
GTGGTGGCTATCGTGGTACCGCTGAACGTGATCTTTGGAGTCACGACGGCATTGGTGCTG
GCCCGCAACCGGTTCCGCGGCAAGGGCGTCTTGCAGGCGATTATCGATCTGCCTTTTGCG
GTTTCACCCGTCATCGTGGGCGTCTCGTTGATCTTGCTGTGGGGATCGGCCGGCGCCCTG
GGCTTCGTCGAGCAGGACCTTGGCTTCAAGATCATCTTCGGGCTGCCGGGAATCGTGCTT
GGCAGCATGTTCGTCACCTGTCCATTCGTGGTGCGCGAAGTGGAACCCGTATTGCACGAA
TTGGGCACCGACCAGGAGCAGGCGGCGGCGACGCTGGGTTCCGGTTGGTGGCAGACATTC
TGGCGAATCACGCTGCCCTCCATCCGGTGGGGCCTGACGTACGGCATCGTATTGACCGTC
GCTCGAACCCTCGGCGAATATGGGGCGGTCATCATCGTCTCGTCGAACCTTCCAGGGACA
TCGCAAACACTGACCCTCTTGGTCTCCGACCGCTACCACCGTGGGGCCGAGTACGGTGCC
TACGCGCTGTCGACGCTGCTGATGGCGGTTTCCGTGGTGGTGCTGATCGTCCAGATGGTG
CTAGACGCCCGCCGGGCACGAGCGGTCAGCGAGGGCTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Term	TBRXN:SULabc sulfate transport via ABC system - ISS	active	njamshidi	2012-10-05
	PMID: 11929522 E. Wooff, SL. Michell et al. Functional genomics reveals the sole sulphate transporter of the Mycobacterium tuberculosis complex and its relevance to the acquisition of sulphur in vivo. Mol. Microbiol. 2002
Term	TBRXN:SULabc sulfate transport via ABC system - IDA	active	njamshidi	2012-10-05
	PMID: 11929522 E. Wooff, SL. Michell et al. Functional genomics reveals the sole sulphate transporter of the Mycobacterium tuberculosis complex and its relevance to the acquisition of sulphur in vivo. Mol. Microbiol. 2002
Interaction	PhysicalInteraction Rv2400c	active	kholia.trupti	2012-10-05
	Gene neighbourhood (Functional linkage) authors,N. Jamshidi,BØ. Palsson Investigating the metabolic capabilities of Mycobacterium tuberculosis H37Rv using the in silico strain iNJ661 and proposing alternative drug targets. BMC Syst Biol 2007
Interaction	PhysicalInteraction Rv2399c	active	kholia.trupti	2012-10-05
	Gene neighbourhood (Functional linkage) authors,N. Jamshidi,BØ. Palsson Investigating the metabolic capabilities of Mycobacterium tuberculosis H37Rv using the in silico strain iNJ661 and proposing alternative drug targets. BMC Syst Biol 2007
Interaction	PhysicalInteraction Rv1739c	active	kholia.trupti	2012-10-05
	Gene neighbourhood (Functional linkage) authors,N. Jamshidi,BØ. Palsson Investigating the metabolic capabilities of Mycobacterium tuberculosis H37Rv using the in silico strain iNJ661 and proposing alternative drug targets. BMC Syst Biol 2007
Interaction	PhysicalInteraction Rv2400c	active	kholia.trupti	2012-10-05
	Gene neighbourhood (Functional linkage) authors,N. Jamshidi,BØ. Palsson Investigating the metabolic capabilities of Mycobacterium tuberculosis H37Rv using the in silico strain iNJ661 and proposing alternative drug targets. BMC Syst Biol 2007
Interaction	PhysicalInteraction Rv2399c	active	kholia.trupti	2012-10-05
	Gene neighbourhood (Functional linkage) authors,N. Jamshidi,BØ. Palsson Investigating the metabolic capabilities of Mycobacterium tuberculosis H37Rv using the in silico strain iNJ661 and proposing alternative drug targets. BMC Syst Biol 2007
Interaction	PhysicalInteraction Rv2397c	active	kholia.trupti	2012-10-05
	Gene neighbourhood (Functional linkage) authors,N. Jamshidi,BØ. Palsson Investigating the metabolic capabilities of Mycobacterium tuberculosis H37Rv using the in silico strain iNJ661 and proposing alternative drug targets. BMC Syst Biol 2007
Interaction	PhysicalInteraction Rv2397c	active	kholia.trupti	2012-10-05
	Gene neighbourhood (Functional linkage) authors,N. Jamshidi,BØ. Palsson Investigating the metabolic capabilities of Mycobacterium tuberculosis H37Rv using the in silico strain iNJ661 and proposing alternative drug targets. BMC Syst Biol 2007
Interaction	PhysicalInteraction Rv1739c	active	vashishtrv	2012-10-05
	authors,N. Jamshidi,BØ. Palsson Investigating the metabolic capabilities of Mycobacterium tuberculosis H37Rv using the in silico strain iNJ661 and proposing alternative drug targets. BMC Syst Biol 2007
Interaction	PhysicalInteraction Rv1739c	active	shahanup86	2012-10-05
	authors,N. Jamshidi,BØ. Palsson Investigating the metabolic capabilities of Mycobacterium tuberculosis H37Rv using the in silico strain iNJ661 and proposing alternative drug targets. BMC Syst Biol 2007
Other	EC:	active	jjmcfadden	2012-03-05
	Inferred from direct assay E. Wooff, SL. Michell et al. Functional genomics reveals the sole sulphate transporter of the Mycobacterium tuberculosis complex and its relevance to the acquisition of sulphur in vivo. Mol. Microbiol. 2002