Rv2400c - sulfate-binding lipoprotein subI

Expression: Most Significant Conditions for Rv2400c

Protein Domains

Gene Information
Locus	Rv2400c
Symbol	subI
Gene Name	sulfate-binding lipoprotein subI
Location	2696644 - 2697714 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:1071 bp Protein:357 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	12389
Related Genes	MAP2213c MAV_1782 Mkms_3545 ML0615 Mmcs_3482 MSMEG_4533 MT2471 MUL_3661 Mvan_3875 nfa14040
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv2400c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv2400c Transcript 1
MLSLTLSEASCIASASRWRHIIPAGVVCALIAGIGVGCHGGPSDVVGRAGPDRAHTSITL
VAYAVPEPGWSAVIPAFNASEQGRGVQVITSYGASADQSRGVADGKPADLVNFSVEPDIA
RLVKAGKVDKDWDADATKGIPFGSVVTFVVRAGNPKNIRDWDDLLRPGIEVITPSPLSSG
SAKWNLLAPYAAKSDGGRNNQAGIDFVNTLVNEHVKLRPGSGREATDVFVQGSGDVLISY
ENEAIATERAGKPVQHVTPPQTFKIENPLAVVATSTHLGAATAFRNFQYTVQAQKLWAQA
GFRPVDPAVAADFADLFPVPAKLWTIADLGGWGSVDPQLFDKATGSITKIYLRATG*

Genomic Sequence

>Rv2400c
ATGCTCTCCTTGACGCTTTCTGAAGCGAGCTGCATCGCTAGCGCATCCCGCTGGCGGCAC
ATTATCCCTGCCGGGGTGGTGTGCGCATTGATCGCCGGTATCGGCGTGGGGTGTCATGGC
GGTCCCAGCGACGTGGTCGGCCGTGCGGGACCGGACCGTGCGCATACGAGCATCACCCTG
GTCGCCTACGCCGTCCCGGAACCCGGCTGGAGTGCGGTGATTCCCGCGTTCAACGCTTCC
GAACAGGGCCGGGGAGTCCAGGTGATTACCTCATATGGCGCGTCGGCCGACCAGTCGCGC
GGTGTTGCCGACGGTAAACCGGCCGACCTGGTGAACTTCTCGGTCGAACCGGACATCGCT
CGCCTGGTCAAGGCCGGCAAGGTTGACAAGGACTGGGACGCCGATGCCACCAAGGGCATC
CCGTTCGGGTCGGTGGTGACGTTTGTGGTCCGCGCGGGTAACCCGAAGAACATCAGAGAT
TGGGATGACCTGTTGCGCCCGGGTATTGAGGTCATCACGCCCAGTCCGCTGAGTTCGGGT
TCTGCCAAGTGGAATCTGCTAGCCCCCTACGCCGCGAAAAGTGACGGTGGCCGGAATAAC
CAAGCGGGGATCGACTTTGTCAATACATTGGTGAATGAACACGTCAAATTGCGCCCCGGG
TCGGGGCGGGAAGCCACCGATGTTTTTGTCCAGGGCAGCGGTGACGTGTTGATCAGCTAC
GAGAACGAAGCCATCGCCACCGAGCGGGCGGGCAAACCGGTGCAGCACGTCACCCCGCCG
CAGACGTTCAAGATCGAAAATCCGTTGGCCGTAGTGGCGACCAGCACACACCTTGGAGCG
GCGACCGCATTCAGAAACTTCCAGTACACCGTGCAGGCGCAGAAGTTATGGGCGCAGGCC
GGTTTCCGGCCGGTCGATCCGGCGGTCGCCGCCGATTTTGCCGACCTGTTTCCGGTGCCG
GCGAAACTGTGGACGATCGCCGACCTCGGTGGCTGGGGCAGCGTGGATCCTCAGCTGTTC
GACAAGGCGACCGGCAGCATCACCAAGATTTATCTGCGGGCCACCGGATGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Term	TBRXN:SULabc sulfate transport via ABC system - ISS	active	njamshidi	2012-10-05
	PMID: 11929522 E. Wooff, SL. Michell et al. Functional genomics reveals the sole sulphate transporter of the Mycobacterium tuberculosis complex and its relevance to the acquisition of sulphur in vivo. Mol. Microbiol. 2002
Term	TBRXN:SULabc sulfate transport via ABC system - IDA	active	njamshidi	2012-10-05
	PMID: 11929522 E. Wooff, SL. Michell et al. Functional genomics reveals the sole sulphate transporter of the Mycobacterium tuberculosis complex and its relevance to the acquisition of sulphur in vivo. Mol. Microbiol. 2002
Interaction	PhysicalInteraction Rv1739c	active	kholia.trupti	2012-10-05
	Gene neighbourhood (Functional linkage) authors,N. Jamshidi,BØ. Palsson Investigating the metabolic capabilities of Mycobacterium tuberculosis H37Rv using the in silico strain iNJ661 and proposing alternative drug targets. BMC Syst Biol 2007
Interaction	PhysicalInteraction Rv2399c	active	kholia.trupti	2012-10-05
	Gene neighbourhood (Functional linkage) authors,N. Jamshidi,BØ. Palsson Investigating the metabolic capabilities of Mycobacterium tuberculosis H37Rv using the in silico strain iNJ661 and proposing alternative drug targets. BMC Syst Biol 2007
Interaction	PhysicalInteraction Rv2398c	active	kholia.trupti	2012-10-05
	Gene neighbourhood (Functional linkage) authors,N. Jamshidi,BØ. Palsson Investigating the metabolic capabilities of Mycobacterium tuberculosis H37Rv using the in silico strain iNJ661 and proposing alternative drug targets. BMC Syst Biol 2007
Interaction	PhysicalInteraction Rv2397c	active	kholia.trupti	2012-10-05
	Gene neighbourhood (Functional linkage) authors,N. Jamshidi,BØ. Palsson Investigating the metabolic capabilities of Mycobacterium tuberculosis H37Rv using the in silico strain iNJ661 and proposing alternative drug targets. BMC Syst Biol 2007
Interaction	PhysicalInteraction Rv2399c	active	kholia.trupti	2012-10-05
	Gene neighbourhood (Functional linkage) authors,N. Jamshidi,BØ. Palsson Investigating the metabolic capabilities of Mycobacterium tuberculosis H37Rv using the in silico strain iNJ661 and proposing alternative drug targets. BMC Syst Biol 2007
Interaction	PhysicalInteraction Rv2398c	active	kholia.trupti	2012-10-05
	Gene neighbourhood (Functional linkage) authors,N. Jamshidi,BØ. Palsson Investigating the metabolic capabilities of Mycobacterium tuberculosis H37Rv using the in silico strain iNJ661 and proposing alternative drug targets. BMC Syst Biol 2007
Interaction	PhysicalInteraction Rv2397c	active	kholia.trupti	2012-10-05
	Gene neighbourhood (Functional linkage) authors,N. Jamshidi,BØ. Palsson Investigating the metabolic capabilities of Mycobacterium tuberculosis H37Rv using the in silico strain iNJ661 and proposing alternative drug targets. BMC Syst Biol 2007
Interaction	PhysicalInteraction Rv1739c	active	vashishtrv	2012-10-05
	authors,N. Jamshidi,BØ. Palsson Investigating the metabolic capabilities of Mycobacterium tuberculosis H37Rv using the in silico strain iNJ661 and proposing alternative drug targets. BMC Syst Biol 2007
Interaction	PhysicalInteraction Rv1739c	active	shahanup86	2012-10-05
	authors,N. Jamshidi,BØ. Palsson Investigating the metabolic capabilities of Mycobacterium tuberculosis H37Rv using the in silico strain iNJ661 and proposing alternative drug targets. BMC Syst Biol 2007
Interaction	RegulatedBy Rv3286c	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. EP. Williams, JH. Lee et al. Mycobacterium tuberculosis SigF regulates genes encoding cell wall-associated proteins and directly regulates the transcriptional regulatory gene phoY1. J. Bacteriol. 2007
Other	EC:	active	jjmcfadden	2012-03-05
	Inferred from direct assay E. Wooff, SL. Michell et al. Functional genomics reveals the sole sulphate transporter of the Mycobacterium tuberculosis complex and its relevance to the acquisition of sulphur in vivo. Mol. Microbiol. 2002