Rv2457c - ATP-dependent clp protease ATP-binding subunit clpX

Expression: Most Significant Conditions for Rv2457c

Protein Domains

Gene Information
Locus	Rv2457c
Symbol	clpX
Gene Name	ATP-dependent clp protease ATP-binding subunit clpX
Location	2758208 - 2759488 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:1281 bp Protein:427 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	942
Related Genes	Acel_0739 BL0943 CE2291 cg2620 DIP1789 jk0546 MAP2278c MAV_1716 Mkms_3649 ML1477 Mmcs_3576 MSMEG_4671 MT2532 MUL_3728 Mvan_4036 nfa13350 PPA1571 SAV5449
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv2457c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv2457c Transcript 1
MARIGDGGDLLKCSFCGKSQKQVKKLIAGPGVYICDECIDLCNEIIEEELADADDVKLDE
LPKPAEIREFLEGYVIGQDTAKRTLAVAVYNHYKRIQAGEKGRDSRCEPVELTKSNILML
GPTGCGKTYLAQTLAKMLNVPFAIADATALTEAGYVGEDVENILLKLIQAADYDVKRAET
GIIYIDEVDKIARKSENPSITRDVSGEGVQQALLKILEGTQASVPPQGGRKHPHQEFIQI
DTTNVLFIVAGAFAGLEKIIYERVGKRGLGFGAEVRSKAEIDTTDHFADVMPEDLIKFGL
IPEFIGRLPVVASVTNLDKESLVKILSEPKNALVKQYIRLFEMDGVELEFTDDALEAIAD
QAIHRGTGARGLRAIMEEVLLPVMYDIPSRDDVAKVVVTKETVQDNVLPTIVPRKPSRSE
RRDKSA*

Genomic Sequence

>Rv2457c
ATGGCGCGCATAGGAGACGGTGGTGACCTGCTGAAGTGCTCGTTCTGCGGGAAGAGCCAA
AAACAGGTCAAGAAGCTCATTGCCGGCCCCGGCGTGTACATCTGCGATGAGTGCATCGAC
CTGTGTAACGAGATCATCGAAGAGGAACTCGCCGACGCCGACGATGTGAAACTCGACGAG
CTGCCCAAGCCGGCCGAGATCCGGGAGTTCCTCGAGGGCTACGTCATCGGGCAAGATACC
GCCAAACGCACGCTGGCCGTGGCGGTGTACAACCACTACAAGCGGATCCAGGCCGGGGAG
AAGGGCCGTGACTCCCGATGTGAGCCCGTTGAGTTGACCAAGTCGAACATCTTGATGCTC
GGACCCACCGGTTGTGGCAAGACCTACCTGGCCCAGACGCTGGCCAAGATGCTTAACGTG
CCGTTTGCCATCGCCGACGCCACCGCGCTGACCGAGGCCGGTTACGTCGGCGAGGACGTC
GAGAACATCTTGCTCAAACTTATTCAGGCCGCCGACTACGACGTCAAACGCGCCGAGACC
GGCATCATCTACATCGACGAGGTCGACAAGATCGCCCGCAAGAGTGAGAACCCGTCGATT
ACTCGCGACGTCTCCGGTGAGGGCGTTCAGCAGGCCTTGCTGAAAATCCTGGAGGGCACT
CAGGCGTCGGTTCCGCCGCAGGGGGGCCGTAAGCACCCGCATCAAGAGTTCATCCAGATC
GACACCACCAACGTGCTGTTCATCGTCGCGGGAGCGTTCGCCGGGCTGGAGAAGATCATT
TACGAGCGCGTCGGCAAGCGGGGCCTCGGCTTTGGCGCCGAGGTTCGTTCCAAGGCCGAG
ATCGACACCACCGACCACTTTGCCGACGTGATGCCGGAGGATCTGATCAAGTTCGGCCTG
ATCCCGGAATTCATCGGCCGCCTGCCGGTGGTCGCCTCGGTCACCAACCTGGACAAAGAG
TCGTTGGTCAAGATCCTGTCCGAGCCGAAGAACGCTTTGGTCAAGCAGTACATCCGGCTG
TTCGAGATGGATGGCGTGGAGTTGGAGTTCACCGACGATGCGCTGGAAGCGATCGCCGAC
CAGGCGATCCATCGCGGCACCGGTGCCCGCGGCCTGCGGGCGATCATGGAAGAAGTCCTG
CTGCCGGTGATGTACGACATCCCGAGCCGCGACGATGTCGCCAAAGTGGTGGTCACCAAG
GAGACCGTGCAGGACAACGTGTTGCCGACAATCGTGCCACGCAAGCCGTCCCGTTCGGAG
CGCCGCGACAAGAGCGCGTAG

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	PhysicalInteraction Rv2461c	active	akankshajain.21	2012-10-05
	Structural analysis authors,A. Gribun,MS. Kimber,R. Ching,R. Sprangers,KM. Fiebig,WA. Houry The ClpP double ring tetradecameric protease exhibits plastic ring-ring interactions, and the N termini of its subunits form flexible loops that are essential for ClpXP and ClpAP complex formation. J. Biol. Chem. 2005
Interaction	PhysicalInteraction Rv2461c	active	akankshajain.21	2012-10-05
	Structural analysis H. Ingvarsson, MJ. Maté et al. Insights into the inter-ring plasticity of caseinolytic proteases from the X-ray structure of Mycobacterium tuberculosis ClpP1. Acta Crystallogr. D Biol. Crystallogr. 2007
Interaction	PhysicalInteraction Rv2461c	active	akankshajain.21	2012-10-05
	Structural analysis AK. Gupta, VM. Katoch et al. Microarray analysis of efflux pump genes in multidrug-resistant Mycobacterium tuberculosis during stress induced by common anti-tuberculous drugs. Microb. Drug Resist. 2010
Interaction	Regulatory Rv2461c	active	richasinha4u	2012-10-05
	Structural Analysis authors,AY. Yu,WA. Houry ClpP: a distinctive family of cylindrical energy-dependent serine proteases. FEBS Lett. 2007
Interaction	Regulatory Rv2461c	active	richasinha4u	2012-10-05
	Structural Analysis authors,S. Gottesman,WP. Clark,MR. Maurizi The ATP-dependent Clp protease of Escherichia coli. Sequence of clpA and identification of a Clp-specific substrate. J. Biol. Chem. 1990
Interaction	Regulatory Rv2461c	active	richasinha4u	2012-10-05
	Structural Analysis authors,MR. Maurizi,WP. Clark,Y. Katayama,S. Rudikoff,J. Pumphrey,B. Bowers,S. Gottesman Sequence and structure of Clp P, the proteolytic component of the ATP-dependent Clp protease of Escherichia coli. J. Biol. Chem. 1990
Interaction	Regulatory Rv2461c	active	richasinha4u	2012-10-05
	Spectrophotometric Analysis authors,AY. Yu,WA. Houry ClpP: a distinctive family of cylindrical energy-dependent serine proteases. FEBS Lett. 2007
Interaction	Regulatory Rv2461c	active	richasinha4u	2012-10-05
	Spectrophotometric Analysis authors,S. Gottesman,WP. Clark,MR. Maurizi The ATP-dependent Clp protease of Escherichia coli. Sequence of clpA and identification of a Clp-specific substrate. J. Biol. Chem. 1990
Interaction	Regulatory Rv2461c	active	richasinha4u	2012-10-05
	Spectrophotometric Analysis authors,MR. Maurizi,WP. Clark,Y. Katayama,S. Rudikoff,J. Pumphrey,B. Bowers,S. Gottesman Sequence and structure of Clp P, the proteolytic component of the ATP-dependent Clp protease of Escherichia coli. J. Biol. Chem. 1990
Interaction	PhysicalInteraction Rv2460c	active	akankshajain.21	2012-10-05
	Structural analysis authors,A. Gribun,MS. Kimber,R. Ching,R. Sprangers,KM. Fiebig,WA. Houry The ClpP double ring tetradecameric protease exhibits plastic ring-ring interactions, and the N termini of its subunits form flexible loops that are essential for ClpXP and ClpAP complex formation. J. Biol. Chem. 2005
Interaction	PhysicalInteraction Rv2460c	active	akankshajain.21	2012-10-05
	Structural analysis AK. Gupta, VM. Katoch et al. Microarray analysis of efflux pump genes in multidrug-resistant Mycobacterium tuberculosis during stress induced by common anti-tuberculous drugs. Microb. Drug Resist. 2010
Interaction	PhysicalInteraction Rv2461c	active	richasinha4u	2012-10-05
	Structural Analysis authors,AY. Yu,WA. Houry ClpP: a distinctive family of cylindrical energy-dependent serine proteases. FEBS Lett. 2007
Interaction	PhysicalInteraction Rv2461c	active	richasinha4u	2012-10-05
	Structural Analysis authors,LW. Donaldson,U. Wojtyra,WA. Houry Solution structure of the dimeric zinc binding domain of the chaperone ClpX. J. Biol. Chem. 2003
Interaction	PhysicalInteraction Rv2461c	active	richasinha4u	2012-10-05
	Structural Analysis authors,B. Banecki,A. Wawrzynow,J. Puzewicz,C. Georgopoulos,M. Zylicz Structure-function analysis of the zinc-binding region of the Clpx molecular chaperone. J. Biol. Chem. 2001
Interaction	PhysicalInteraction Rv2461c	active	richasinha4u	2012-10-05
	Spectrophotometric Analysis authors,AY. Yu,WA. Houry ClpP: a distinctive family of cylindrical energy-dependent serine proteases. FEBS Lett. 2007
Interaction	PhysicalInteraction Rv2461c	active	richasinha4u	2012-10-05
	Spectrophotometric Analysis authors,LW. Donaldson,U. Wojtyra,WA. Houry Solution structure of the dimeric zinc binding domain of the chaperone ClpX. J. Biol. Chem. 2003
Interaction	PhysicalInteraction Rv2461c	active	richasinha4u	2012-10-05
	Spectrophotometric Analysis authors,B. Banecki,A. Wawrzynow,J. Puzewicz,C. Georgopoulos,M. Zylicz Structure-function analysis of the zinc-binding region of the Clpx molecular chaperone. J. Biol. Chem. 2001
Interaction	PhysicalInteraction Rv2461c	active	vmevada102	2012-10-05
	Structural analysis authors,A. Gribun,MS. Kimber,R. Ching,R. Sprangers,KM. Fiebig,WA. Houry The ClpP double ring tetradecameric protease exhibits plastic ring-ring interactions, and the N termini of its subunits form flexible loops that are essential for ClpXP and ClpAP complex formation. J. Biol. Chem. 2005
Interaction	PhysicalInteraction Rv2460c	active	vmevada102	2012-10-05
	Structural analysis authors,A. Gribun,MS. Kimber,R. Ching,R. Sprangers,KM. Fiebig,WA. Houry The ClpP double ring tetradecameric protease exhibits plastic ring-ring interactions, and the N termini of its subunits form flexible loops that are essential for ClpXP and ClpAP complex formation. J. Biol. Chem. 2005
Interaction	PhysicalInteraction Rv2461c	active	vmevada102	2012-10-05
	Structural analysis AK. Gupta, VM. Katoch et al. Microarray analysis of efflux pump genes in multidrug-resistant Mycobacterium tuberculosis during stress induced by common anti-tuberculous drugs. Microb. Drug Resist. 2010
Interaction	PhysicalInteraction Rv2460c	active	vmevada102	2012-10-05
	Structural analysis AK. Gupta, VM. Katoch et al. Microarray analysis of efflux pump genes in multidrug-resistant Mycobacterium tuberculosis during stress induced by common anti-tuberculous drugs. Microb. Drug Resist. 2010
Interaction	RegulatedBy Rv1221	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. R. Manganelli, MI. Voskuil et al. The Mycobacterium tuberculosis ECF sigma factor sigmaE: role in global gene expression and survival in macrophages. Mol. Microbiol. 2001