Rv2466c - conserved hypothetical protein

Expression: Most Significant Conditions for Rv2466c

Protein Domains

Gene Information
Locus	Rv2466c
Symbol
Gene Name	conserved hypothetical protein
Location	2768261 - 2768884 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:624 bp Protein:208 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	19050
Related Genes	Acel_1829 CE2319 cg2661 DIP1797 jk0540 MAP2286c MAV_1706 Mkms_3676 ML1485 Mmcs_3603 MSMEG_4688 Mvan_4056 nfa13250 SAV5412
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv2466c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv2466c Transcript 1
MLEKAPQKSVADFWFDPLCPWCWITSRWILEVAKVRDIEVNFHVMSLAILNENRDDLPEQ
YREGMARAWGPVRVAIAAEQAHGAKVLDPLYTAMGNRIHNQGNHELDEVITQSLADAGLP
AELAKAATSDAYDNALRKSHHAGMDAVGEDVGTPTIHVNGVAFFGPVLSKIPRGEEAGKL
WDASVTFASYPHFFELKRTRTEPPQFD*

Genomic Sequence

>Rv2466c
ATGCTCGAGAAGGCCCCCCAGAAGTCTGTCGCCGATTTCTGGTTCGATCCGCTGTGCCCG
TGGTGCTGGATCACGTCGCGCTGGATCCTCGAGGTGGCAAAGGTCCGCGACATCGAGGTG
AACTTCCACGTCATGAGCCTGGCAATACTCAACGAAAACCGTGACGACCTGCCCGAGCAA
TACCGCGAAGGCATGGCGAGGGCATGGGGACCGGTACGGGTGGCGATCGCCGCCGAGCAG
GCCCATGGGGCGAAAGTCCTGGACCCGCTGTACACCGCGATGGGCAACCGGATTCACAAC
CAGGGCAACCACGAACTCGACGAGGTCATCACCCAGTCGCTGGCGGACGCCGGTCTGCCC
GCGGAGTTGGCCAAGGCCGCTACCAGCGACGCTTACGACAACGCCCTGCGCAAAAGCCAC
CACGCCGGGATGGACGCGGTGGGCGAGGACGTCGGTACGCCGACGATCCATGTCAATGGT
GTGGCGTTCTTCGGGCCGGTGCTCTCGAAGATTCCGCGCGGCGAGGAAGCCGGCAAGCTC
TGGGATGCCTCGGTTACCTTCGCTTCCTACCCGCACTTTTTTGAGCTCAAGCGGACCCGC
ACCGAGCCGCCTCAGTTCGACTAG

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Transcription Rv3223c	active	sourish10	2012-10-05
	Co-expression (Functional linkage) ST. Park, CM. Kang et al. Regulation of the SigH stress response regulon by an essential protein kinase in Mycobacterium tuberculosis. Proc. Natl. Acad. Sci. U.S.A. 2008
Interaction	Transcription Rv3223c	active	sourish10	2012-10-05
	Co-expression (Functional linkage) ST. Park, CM. Kang et al. Regulation of the SigH stress response regulon by an essential protein kinase in Mycobacterium tuberculosis. Proc. Natl. Acad. Sci. U.S.A. 2008
Interaction	Transcription Rv3223c	active	sourish10	2012-10-05
	Co-expression (Functional linkage) P. Sachdeva,R. Misra,AK. Tyagi,Y. Singh The sigma factors of Mycobacterium tuberculosis: regulation of the regulators. FEBS J. 2010
Interaction	Transcription Rv3223c	active	sourish10	2012-10-05
	Co-expression (Functional linkage) P. Sachdeva,R. Misra,AK. Tyagi,Y. Singh The sigma factors of Mycobacterium tuberculosis: regulation of the regulators. FEBS J. 2010
Interaction	Transcription Rv3223c	active	sourish10	2012-10-05
	Co-expression (Functional linkage) S. Raman, T. Song et al. The alternative sigma factor SigH regulates major components of oxidative and heat stress responses in Mycobacterium tuberculosis. J. Bacteriol. 2001
Interaction	Transcription Rv3223c	active	sourish10	2012-10-05
	Co-expression (Functional linkage) S. Raman, T. Song et al. The alternative sigma factor SigH regulates major components of oxidative and heat stress responses in Mycobacterium tuberculosis. J. Bacteriol. 2001
Interaction	Transcription Rv3223c	active	sourish10	2012-10-05
	Co-expression (Functional linkage) ST. Park, CM. Kang et al. Regulation of the SigH stress response regulon by an essential protein kinase in Mycobacterium tuberculosis. Proc. Natl. Acad. Sci. U.S.A. 2008
Interaction	Transcription Rv3223c	active	sourish10	2012-10-05
	Co-expression (Functional linkage) ST. Park, CM. Kang et al. Regulation of the SigH stress response regulon by an essential protein kinase in Mycobacterium tuberculosis. Proc. Natl. Acad. Sci. U.S.A. 2008
Interaction	Transcription Rv3223c	active	sourish10	2012-10-05
	Co-expression (Functional linkage) P. Sachdeva,R. Misra,AK. Tyagi,Y. Singh The sigma factors of Mycobacterium tuberculosis: regulation of the regulators. FEBS J. 2010
Interaction	Transcription Rv3223c	active	sourish10	2012-10-05
	Co-expression (Functional linkage) P. Sachdeva,R. Misra,AK. Tyagi,Y. Singh The sigma factors of Mycobacterium tuberculosis: regulation of the regulators. FEBS J. 2010
Interaction	Transcription Rv3223c	active	sourish10	2012-10-05
	Co-expression (Functional linkage) S. Raman, T. Song et al. The alternative sigma factor SigH regulates major components of oxidative and heat stress responses in Mycobacterium tuberculosis. J. Bacteriol. 2001
Interaction	Transcription Rv3223c	active	sourish10	2012-10-05
	Co-expression (Functional linkage) S. Raman, T. Song et al. The alternative sigma factor SigH regulates major components of oxidative and heat stress responses in Mycobacterium tuberculosis. J. Bacteriol. 2001
Interaction	Regulatory Rv3223c	active	vmevada102	2012-10-05
	authors,M. Alonso-Hearn,D. Patel,L. Danelishvili,L. Meunier-Goddik,LE. Bermudez The Mycobacterium avium subsp. paratuberculosis MAP3464 gene encodes an oxidoreductase involved in invasion of bovine epithelial cells through the activation of host cell Cdc42. Infect. Immun. 2008
Interaction	Regulatory Rv3223c	active	vmevada102	2012-10-05
	S. Raman, T. Song et al. The alternative sigma factor SigH regulates major components of oxidative and heat stress responses in Mycobacterium tuberculosis. J. Bacteriol. 2001
Interaction	Regulatory Rv0182c	active	priti.priety	2012-10-05
	Co-expression (Functional linkage) JH. Lee, DE. Geiman et al. Role of stress response sigma factor SigG in Mycobacterium tuberculosis. J. Bacteriol. 2008
Interaction	RegulatedBy Rv0182c	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. JH. Lee, DE. Geiman et al. Role of stress response sigma factor SigG in Mycobacterium tuberculosis. J. Bacteriol. 2008
Interaction	RegulatedBy Rv3223c	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008