Rv2527 - conserved hypothetical protein

Expression: Most Significant Conditions for Rv2527

Protein Domains

Gene Information
Locus	Rv2527
Symbol
Gene Name	conserved hypothetical protein
Location	2851315 - 2851716 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:402 bp Protein:134 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	11593
Related Genes	MT2602
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv2527
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv2527 Transcript 1
MTTWILDKSAHVRLVAGATPPAGIDLTDLAICDIGELEWLYSARSATDYDSQQTSLRAYQ
ILRAPSDIFDRVRHLQRDLAHHRGMWHRTPLPDLFIAETALHHRAGVLHHDRDYKRIAVV
RPGFQACELSRGR*

Genomic Sequence

>Rv2527
ATGACCACCTGGATTCTGGACAAGAGTGCCCACGTGCGACTCGTGGCCGGCGCCACGCCG
CCAGCCGGCATCGACCTCACCGACCTCGCCATCTGCGATATCGGCGAACTTGAATGGCTG
TATTCAGCACGGTCAGCTACCGACTACGACAGCCAACAAACGTCACTGCGCGCCTATCAA
ATCCTTCGCGCACCCAGCGACATCTTTGACCGGGTTCGCCACCTTCAGCGCGACCTAGCC
CACCACCGTGGGATGTGGCATCGAACGCCGCTTCCGGACCTATTCATCGCCGAAACCGCG
CTTCATCACCGGGCCGGCGTGTTGCACCACGACCGTGACTACAAACGAATTGCCGTCGTA
CGGCCTGGGTTTCAAGCATGCGAACTCTCTCGCGGGCGCTAG

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Inhibition Rv2526	active	soumisengupta	2012-10-05
	Co-expression (Functional linkage) authors,A. Gupta Killing activity and rescue function of genome-wide toxin-antitoxin loci of Mycobacterium tuberculosis. FEMS Microbiol. Lett. 2009
Interaction	Inhibition Rv2526	active	soumisengupta	2012-10-05
	Co-expression (Functional linkage) authors,VL. Arcus,PB. Rainey,SJ. Turner The PIN-domain toxin-antitoxin array in mycobacteria. Trends Microbiol. 2005
Interaction	InhibitedBy Rv2526	active	kandarpbioinfo	2012-10-05
	Gene neighbourhood authors,HR. Ramage,LE. Connolly,JS. Cox Comprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. PLoS Genet. 2009
Interaction	InhibitedBy Rv2526	active	kandarpbioinfo	2012-10-05
	Gene neighbourhood authors,DP. Pandey,K. Gerdes Toxin-antitoxin loci are highly abundant in free-living but lost from host-associated prokaryotes. Nucleic Acids Res. 2005
Interaction	InhibitedBy Rv2526	active	kandarpbioinfo	2012-10-05
	Gene neighbourhood authors,VL. Arcus,PB. Rainey,SJ. Turner The PIN-domain toxin-antitoxin array in mycobacteria. Trends Microbiol. 2005
Symbol	VapC17	active	jlew	2012-03-07
	We report the heterologous toxicity of these TA loci in Escherichia coli and show that only a few of the M. tuberculosis-encoded toxins can inhibit E. coli growth and have a killing effect. This killing effect can be suppressed by coexpression of the cognate antitoxin. authors,A. Gupta Killing activity and rescue function of genome-wide toxin-antitoxin loci of Mycobacterium tuberculosis. FEMS Microbiol. Lett. 2009
Other	strand:+	active	rslayden	2012-03-05
	Rv0229c (226 aa), FASTA scores: opt: 153, E(): 0.0011, (32.8% identity in 128 aa overlap).
Other	stop:2851716	active	rslayden	2012-03-05
	Rv0229c (226 aa), FASTA scores: opt: 153, E(): 0.0011, (32.8% identity in 128 aa overlap).
Other	start:2851315	active	rslayden	2012-03-05
	Rv0229c (226 aa), FASTA scores: opt: 153, E(): 0.0011, (32.8% identity in 128 aa overlap).
Other	strand:+	active	rslayden	2012-03-05
	MTCY08D5.24c
Other	stop:2851716	active	rslayden	2012-03-05
	MTCY08D5.24c
Other	start:2851315	active	rslayden	2012-03-05
	MTCY08D5.24c
Other	strand:+	active	rslayden	2012-03-05
	Rv2757c (138 aa), FASTA scores: opt: 201, E(): 3.1e-07, (35.7% identity in 126 aa overlap); and P96411
Other	stop:2851716	active	rslayden	2012-03-05
	Rv2757c (138 aa), FASTA scores: opt: 201, E(): 3.1e-07, (35.7% identity in 126 aa overlap); and P96411
Other	start:2851315	active	rslayden	2012-03-05
	Rv2757c (138 aa), FASTA scores: opt: 201, E(): 3.1e-07, (35.7% identity in 126 aa overlap); and P96411
Other	strand:+	active	rslayden	2012-03-05
	MTV002.22c
Other	stop:2851716	active	rslayden	2012-03-05
	MTV002.22c
Other	start:2851315	active	rslayden	2012-03-05
	MTV002.22c
Other	strand:+	active	rslayden	2012-03-05
	Rv2546 (137 aa), FASTA scores: opt: 206, E(): 1.4e-07, (38.0% identity in 100 aa overlap); O33299
Other	stop:2851716	active	rslayden	2012-03-05
	Rv2546 (137 aa), FASTA scores: opt: 206, E(): 1.4e-07, (38.0% identity in 100 aa overlap); O33299
Other	start:2851315	active	rslayden	2012-03-05
	Rv2546 (137 aa), FASTA scores: opt: 206, E(): 1.4e-07, (38.0% identity in 100 aa overlap); O33299
Other	strand:+	active	rslayden	2012-03-05
	MTCY159.10c
Other	stop:2851716	active	rslayden	2012-03-05
	MTCY159.10c
Other	start:2851315	active	rslayden	2012-03-05
	MTCY159.10c
Other	strand:+	active	rslayden	2012-03-05
	Hypothetical protein, showing some similarity to hypothetical proteins from Mycobacterium tuberculosis e.g. P95007
Other	stop:2851716	active	rslayden	2012-03-05
	Hypothetical protein, showing some similarity to hypothetical proteins from Mycobacterium tuberculosis e.g. P95007
Other	start:2851315	active	rslayden	2012-03-05
	Hypothetical protein, showing some similarity to hypothetical proteins from Mycobacterium tuberculosis e.g. P95007