Rv2545 - conserved hypothetical protein

Expression: Most Significant Conditions for Rv2545

Protein Domains

Gene Information
Locus	Rv2545
Symbol
Gene Name	conserved hypothetical protein
Location	2867783 - 2868061 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:279 bp Protein:93 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	9144
Related Genes	MT2621
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv2545
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv2545 Transcript 1
MSTTIVAGVIQGHLPVILPTRRRARDLGHTTALFRAQTLQCIYLSIEYLYVCSMSRRTTI
DIDDILLARAQAALGTTGLKDRVDAALRAAVR*

Genomic Sequence

>Rv2545
GTGAGCACCACCATCGTTGCTGGCGTGATCCAGGGTCACCTGCCGGTGATCCTGCCCACG
CGCAGGCGGGCTCGCGATCTCGGGCACACGACGGCGTTATTTCGGGCGCAAACGCTCCAA
TGCATATATCTCAGTATCGAATACCTATATGTTTGCTCCATGTCTCGGCGTACAACGATC
GACATCGATGACATACTGCTGGCCCGCGCGCAAGCGGCGCTCGGTACCACCGGGCTGAAG
GACAGGGTCGATGCCGCTTTGCGAGCCGCGGTGCGCTAG

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Regulatory Rv2546	active	soumisengupta	2012-10-05
	Gene Neighborhood (Functional linkage) authors,HR. Ramage,LE. Connolly,JS. Cox Comprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. PLoS Genet. 2009
Interaction	Regulatory Rv2546	active	soumisengupta	2012-10-05
	Gene Neighborhood (Functional linkage) authors,VL. Arcus,PB. Rainey,SJ. Turner The PIN-domain toxin-antitoxin array in mycobacteria. Trends Microbiol. 2005
Interaction	Regulatory Rv2546	active	soumisengupta	2012-10-05
	Gene Neighborhood (Functional linkage) authors,HR. Ramage,LE. Connolly,JS. Cox Comprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. PLoS Genet. 2009
Interaction	Regulatory Rv2546	active	soumisengupta	2012-10-05
	Gene Neighborhood (Functional linkage) authors,VL. Arcus,PB. Rainey,SJ. Turner The PIN-domain toxin-antitoxin array in mycobacteria. Trends Microbiol. 2005
Symbol	VapB	active	jlew	2012-03-07
	authors,BA. Ahidjo,D. Kuhnert,JL. McKenzie,EE. Machowski,BG. Gordhan,V. Arcus,GL. Abrahams,V. Mizrahi VapC toxins from Mycobacterium tuberculosis are ribonucleases that differentially inhibit growth and are neutralized by cognate VapB antitoxins. PLoS ONE 2011
Symbol	VapB18	active	jlew	2012-03-07
	We report the heterologous toxicity of these TA loci in Escherichia coli and show that only a few of the M. tuberculosis-encoded toxins can inhibit E. coli growth and have a killing effect. This killing effect can be suppressed by coexpression of the cognate antitoxin. authors,A. Gupta Killing activity and rescue function of genome-wide toxin-antitoxin loci of Mycobacterium tuberculosis. FEMS Microbiol. Lett. 2009
Other	strand:+	active	rslayden	2012-03-05
	MTCY48.05 PROTEIN from Mycobacterium tuberculosis (72 aa), FASTA scores: opt: 84, E(): 8.2,(46.5% identity in 43 aa overlap)
Other	stop:2868061	active	rslayden	2012-03-05
	MTCY48.05 PROTEIN from Mycobacterium tuberculosis (72 aa), FASTA scores: opt: 84, E(): 8.2,(46.5% identity in 43 aa overlap)
Other	start:2867783	active	rslayden	2012-03-05
	MTCY48.05 PROTEIN from Mycobacterium tuberculosis (72 aa), FASTA scores: opt: 84, E(): 8.2,(46.5% identity in 43 aa overlap)
Symbol	Vap BC-18	active	rslayden	2012-03-05
	MTCY48.05 PROTEIN from Mycobacterium tuberculosis (72 aa), FASTA scores: opt: 84, E(): 8.2,(46.5% identity in 43 aa overlap)
Other	strand:+	active	rslayden	2012-03-05
	MT1611
Other	stop:2868061	active	rslayden	2012-03-05
	MT1611
Other	start:2867783	active	rslayden	2012-03-05
	MT1611
Symbol	Vap BC-18	active	rslayden	2012-03-05
	MT1611
Other	strand:+	active	rslayden	2012-03-05
	Rv1560
Other	stop:2868061	active	rslayden	2012-03-05
	Rv1560
Other	start:2867783	active	rslayden	2012-03-05
	Rv1560
Symbol	Vap BC-18	active	rslayden	2012-03-05
	Rv1560
Other	strand:+	active	rslayden	2012-03-05
	MTV002.23c PROTEIN from Mycobacterium tuberculosis (88 aa), FASTA scores: opt: 151, E():9.8e-05, (66.65% identity in 45 aa overlap); and Q10771
Other	stop:2868061	active	rslayden	2012-03-05
	MTV002.23c PROTEIN from Mycobacterium tuberculosis (88 aa), FASTA scores: opt: 151, E():9.8e-05, (66.65% identity in 45 aa overlap); and Q10771
Other	start:2867783	active	rslayden	2012-03-05
	MTV002.23c PROTEIN from Mycobacterium tuberculosis (88 aa), FASTA scores: opt: 151, E():9.8e-05, (66.65% identity in 45 aa overlap); and Q10771
Symbol	Vap BC-18	active	rslayden	2012-03-05
	MTV002.23c PROTEIN from Mycobacterium tuberculosis (88 aa), FASTA scores: opt: 151, E():9.8e-05, (66.65% identity in 45 aa overlap); and Q10771
Other	strand:+	active	rslayden	2012-03-05
	Rv2758c
Other	stop:2868061	active	rslayden	2012-03-05
	Rv2758c
Other	start:2867783	active	rslayden	2012-03-05
	Rv2758c
Symbol	Vap BC-18	active	rslayden	2012-03-05
	Rv2758c
Other	strand:+	active	rslayden	2012-03-05
	Conserved hypothetical protein. C-terminus highly similar to O33300
Other	stop:2868061	active	rslayden	2012-03-05
	Conserved hypothetical protein. C-terminus highly similar to O33300
Other	start:2867783	active	rslayden	2012-03-05
	Conserved hypothetical protein. C-terminus highly similar to O33300
Symbol	Vap BC-18	active	rslayden	2012-03-05
	Conserved hypothetical protein. C-terminus highly similar to O33300