Rv2547 - conserved hypothetical protein

Expression: Most Significant Conditions for Rv2547

Protein Domains

Gene Information
Locus	Rv2547
Symbol
Gene Name	conserved hypothetical protein
Location	2868606 - 2868863 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:258 bp Protein:86 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	9145
Related Genes	MT2623
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv2547
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv2547 Transcript 1
MRTQVTLGKEELELLDRAAKASGASRSELIRRAIHRAYGTGSKQERLAALDHSRGSWRGR
DFTGTEYVDAIRGDLNERLARLGLA*

Genomic Sequence

>Rv2547
ATGCGGACTCAGGTGACCCTGGGCAAAGAGGAGCTTGAGCTGCTCGATCGTGCCGCCAAG
GCGAGTGGCGCATCGCGGTCCGAACTCATCCGACGCGCAATTCACCGTGCCTACGGGACT
GGATCCAAGCAGGAACGGCTCGCCGCGCTCGACCACAGCCGTGGCTCGTGGCGAGGACGG
GACTTCACCGGCACCGAGTATGTCGACGCCATTCGGGGCGACCTCAACGAACGACTTGCT
CGGCTCGGTCTGGCGTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Regulatory Rv2548	active	soumisengupta	2012-10-05
	Gene Neighborhood (Functional linkage) authors,HR. Ramage,LE. Connolly,JS. Cox Comprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. PLoS Genet. 2009
Interaction	Regulatory Rv2548	active	soumisengupta	2012-10-05
	Gene Neighborhood (Functional linkage) authors,VL. Arcus,PB. Rainey,SJ. Turner The PIN-domain toxin-antitoxin array in mycobacteria. Trends Microbiol. 2005
Interaction	Regulatory Rv2548	active	soumisengupta	2012-10-05
	Gene Neighborhood (Functional linkage) authors,HR. Ramage,LE. Connolly,JS. Cox Comprehensive functional analysis of Mycobacterium tuberculosis toxin-antitoxin systems: implications for pathogenesis, stress responses, and evolution. PLoS Genet. 2009
Interaction	Regulatory Rv2548	active	soumisengupta	2012-10-05
	Gene Neighborhood (Functional linkage) authors,VL. Arcus,PB. Rainey,SJ. Turner The PIN-domain toxin-antitoxin array in mycobacteria. Trends Microbiol. 2005
Symbol	VapB	active	jlew	2012-03-07
	authors,BA. Ahidjo,D. Kuhnert,JL. McKenzie,EE. Machowski,BG. Gordhan,V. Arcus,GL. Abrahams,V. Mizrahi VapC toxins from Mycobacterium tuberculosis are ribonucleases that differentially inhibit growth and are neutralized by cognate VapB antitoxins. PLoS ONE 2011
Symbol	VapB19	active	jlew	2012-03-07
	We report the heterologous toxicity of these TA loci in Escherichia coli and show that only a few of the M. tuberculosis-encoded toxins can inhibit E. coli growth and have a killing effect. This killing effect can be suppressed by coexpression of the cognate antitoxin. authors,A. Gupta Killing activity and rescue function of genome-wide toxin-antitoxin loci of Mycobacterium tuberculosis. FEMS Microbiol. Lett. 2009
Other	strand:+	active	rslayden	2012-03-05
	SSO10342 HYPOTHETICAL PROTEIN from Sulfolobus solfataricus (58 aa), FASTA scores: opt: 94, E(): 2.3, (46.95% identity in 49 aa overlap)
Other	stop:2868863	active	rslayden	2012-03-05
	SSO10342 HYPOTHETICAL PROTEIN from Sulfolobus solfataricus (58 aa), FASTA scores: opt: 94, E(): 2.3, (46.95% identity in 49 aa overlap)
Other	start:2868606	active	rslayden	2012-03-05
	SSO10342 HYPOTHETICAL PROTEIN from Sulfolobus solfataricus (58 aa), FASTA scores: opt: 94, E(): 2.3, (46.95% identity in 49 aa overlap)
Symbol	Vap BC-19	active	rslayden	2012-03-05
	SSO10342 HYPOTHETICAL PROTEIN from Sulfolobus solfataricus (58 aa), FASTA scores: opt: 94, E(): 2.3, (46.95% identity in 49 aa overlap)
Other	strand:+	active	rslayden	2012-03-05
	SMC01933 CONSERvED HYPOTHETICAL PROTEIN from Rhizobium meliloti (Sinorhizobium meliloti)(71 aa), FASTA scores: opt: 105, E(): 0.46, (28.4% identity in 74 aa overlap); Q97W38
Other	stop:2868863	active	rslayden	2012-03-05
	SMC01933 CONSERvED HYPOTHETICAL PROTEIN from Rhizobium meliloti (Sinorhizobium meliloti)(71 aa), FASTA scores: opt: 105, E(): 0.46, (28.4% identity in 74 aa overlap); Q97W38
Other	start:2868606	active	rslayden	2012-03-05
	SMC01933 CONSERvED HYPOTHETICAL PROTEIN from Rhizobium meliloti (Sinorhizobium meliloti)(71 aa), FASTA scores: opt: 105, E(): 0.46, (28.4% identity in 74 aa overlap); Q97W38
Symbol	Vap BC-19	active	rslayden	2012-03-05
	SMC01933 CONSERvED HYPOTHETICAL PROTEIN from Rhizobium meliloti (Sinorhizobium meliloti)(71 aa), FASTA scores: opt: 105, E(): 0.46, (28.4% identity in 74 aa overlap); Q97W38
Other	strand:+	active	rslayden	2012-03-05
	MTCY21B4.15c HYPOTHETICAL 9.4 KDA PROTEIN from Mycobacterium tuberculosis (85 aa),FASTA scores: opt: 108, E(): 0.33, (37.1% identity in 62aa overlap); CAC45864
Other	stop:2868863	active	rslayden	2012-03-05
	MTCY21B4.15c HYPOTHETICAL 9.4 KDA PROTEIN from Mycobacterium tuberculosis (85 aa),FASTA scores: opt: 108, E(): 0.33, (37.1% identity in 62aa overlap); CAC45864
Other	start:2868606	active	rslayden	2012-03-05
	MTCY21B4.15c HYPOTHETICAL 9.4 KDA PROTEIN from Mycobacterium tuberculosis (85 aa),FASTA scores: opt: 108, E(): 0.33, (37.1% identity in 62aa overlap); CAC45864
Symbol	Vap BC-19	active	rslayden	2012-03-05
	MTCY21B4.15c HYPOTHETICAL 9.4 KDA PROTEIN from Mycobacterium tuberculosis (85 aa),FASTA scores: opt: 108, E(): 0.33, (37.1% identity in 62aa overlap); CAC45864
Other	strand:+	active	rslayden	2012-03-05
	MT1442
Other	stop:2868863	active	rslayden	2012-03-05
	MT1442
Other	start:2868606	active	rslayden	2012-03-05
	MT1442
Symbol	Vap BC-19	active	rslayden	2012-03-05
	MT1442
Other	strand:+	active	rslayden	2012-03-05
	Rv1398c
Other	stop:2868863	active	rslayden	2012-03-05
	Rv1398c
Other	start:2868606	active	rslayden	2012-03-05
	Rv1398c
Symbol	Vap BC-19	active	rslayden	2012-03-05
	Rv1398c
Other	strand:+	active	rslayden	2012-03-05
	YD98_MYCTU
Other	stop:2868863	active	rslayden	2012-03-05
	YD98_MYCTU
Other	start:2868606	active	rslayden	2012-03-05
	YD98_MYCTU
Symbol	Vap BC-19	active	rslayden	2012-03-05
	YD98_MYCTU
Other	strand:+	active	rslayden	2012-03-05
	Conserved hypothetical protein. Some similarity to P71666
Other	stop:2868863	active	rslayden	2012-03-05
	Conserved hypothetical protein. Some similarity to P71666
Other	start:2868606	active	rslayden	2012-03-05
	Conserved hypothetical protein. Some similarity to P71666
Symbol	Vap BC-19	active	rslayden	2012-03-05
	Conserved hypothetical protein. Some similarity to P71666