Rv2595 - conserved hypothetical protein

Expression: Most Significant Conditions for Rv2595

Protein Domains

Gene Information
Locus	Rv2595
Symbol
Gene Name	conserved hypothetical protein
Location	2925492 - 2925737 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:246 bp Protein:82 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	9728
Related Genes
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv2595
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv2595 Transcript 1
MRTTIDVAGRLVIPKRIRERLGLRGNDQVEITERDGRIEIEPAPTGVELVREGSVLVARP
ERPLPPLTDEIVRETLDRTRR*

Genomic Sequence

>Rv2595
ATGCGAACAACCATCGATGTCGCAGGACGTCTGGTGATTCCCAAGCGGATTCGCGAGCGC
CTTGGCTTGCGCGGGAACGACCAGGTGGAGATCACCGAGCGCGATGGGCGCATCGAGATT
GAGCCGGCCCCGACCGGTGTCGAACTCGTTCGGGAAGGCTCGGTTCTCGTCGCACGGCCA
GAACGTCCCCTGCCCCCGTTGACCGACGAAATCGTTCGGGAAACGCTCGATCGCACACGG
CGGTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Operon Rv2596	active	xaccheus	2012-10-05
	Structural Analysis authors,VL. Arcus,K. Bäckbro,A. Roos,EL. Daniel,EN. Baker Distant structural homology leads to the functional characterization of an archaeal PIN domain as an exonuclease. J. Biol. Chem. 2004
Interaction	Operon Rv2596	active	xaccheus	2012-10-05
	Spectrophotometric authors,VL. Arcus,K. Bäckbro,A. Roos,EL. Daniel,EN. Baker Distant structural homology leads to the functional characterization of an archaeal PIN domain as an exonuclease. J. Biol. Chem. 2004
Interaction	Operon Rv2596	active	xaccheus	2012-10-05
	Structural Analysis authors,J. Robson,JL. McKenzie,R. Cursons,GM. Cook,VL. Arcus The vapBC operon from Mycobacterium smegmatis is an autoregulated toxin-antitoxin module that controls growth via inhibition of translation. J. Mol. Biol. 2009
Interaction	Operon Rv2596	active	xaccheus	2012-10-05
	Structural Analysis authors,VL. Arcus,PB. Rainey,SJ. Turner The PIN-domain toxin-antitoxin array in mycobacteria. Trends Microbiol. 2005
Interaction	Operon Rv2596	active	xaccheus	2012-10-05
	Spectrophotometric authors,J. Robson,JL. McKenzie,R. Cursons,GM. Cook,VL. Arcus The vapBC operon from Mycobacterium smegmatis is an autoregulated toxin-antitoxin module that controls growth via inhibition of translation. J. Mol. Biol. 2009
Interaction	Operon Rv2596	active	xaccheus	2012-10-05
	Spectrophotometric authors,VL. Arcus,PB. Rainey,SJ. Turner The PIN-domain toxin-antitoxin array in mycobacteria. Trends Microbiol. 2005
Symbol	vapB-mt25	active	jlew	2012-03-07
	No growth when mazF-mt1 expressed in Ecoli but restored when mazE-mt1 was co-induced. mazF-mt1 could also be partially neutralized by vapB-mt24 or vapB-mt25. Growth inhibition by mazF-mt3; normal growth if mazE-mt1, mazE-mt3, vapB-mt24 or vapB-mt25 were co-expressed. Each pair shows interaction by pull-down. authors,L. Zhu,JD. Sharp,H. Kobayashi,NA. Woychik,M. Inouye Noncognate Mycobacterium tuberculosis toxin-antitoxins can physically and functionally interact. J. Biol. Chem. 2010