Rv2699c - conserved hypothetical protein

Expression: Most Significant Conditions for Rv2699c

Protein Domains

Gene Information
Locus	Rv2699c
Symbol
Gene Name	conserved hypothetical protein
Location	3014663 - 3014965 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:303 bp Protein:101 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	33413
Related Genes	Acel_1404 BL1437 CE1801 cg2089 DIP1402 jk1084 MAP2816c MAV_3591 Mkms_2235 ML1026 Mmcs_2189 MSMEG_2763 MT2773 MUL_3337 Mvan_2465 nfa37550 PPA1051 SAV2403
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv2699c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv2699c Transcript 1
MPTDYDAPRRTETDDVSEDSLEELKARRNEAASAVVDVDESESAESFELPGADLSGEELS
VRVVPKQADEFTCSSCFLVQHRSRLASEKNGVMICTDCAA*

Genomic Sequence

>Rv2699c
ATGCCTACCGACTATGACGCTCCGCGGCGTACCGAGACCGATGATGTCTCGGAGGACTCG
CTTGAAGAGCTCAAAGCACGACGGAACGAGGCGGCGTCGGCCGTGGTCGACGTGGACGAA
TCCGAATCCGCCGAGTCCTTCGAACTGCCTGGCGCCGACCTGTCCGGCGAAGAACTGTCG
GTGCGCGTCGTACCCAAGCAAGCTGACGAATTCACCTGCTCGAGTTGCTTTTTGGTGCAA
CACCGCAGCAGGTTGGCCAGCGAGAAGAACGGCGTGATGATCTGCACCGACTGCGCCGCC
TGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Transcription Rv3676	active	jgalag	2012-10-05
	Band shift M. Stapleton, I. Haq et al. Mycobacterium tuberculosis cAMP receptor protein (Rv3676) differs from the Escherichia coli paradigm in its cAMP binding and DNA binding properties and transcription activation properties. J. Biol. Chem. 2010
Interaction	Transcription Rv3676	active	jgalag	2012-10-05
	Band shift G. Bai, LA. McCue et al. Characterization of Mycobacterium tuberculosis Rv3676 (CRPMt), a cyclic AMP receptor protein-like DNA binding protein. J. Bacteriol. 2005
Interaction	RegulatedBy Rv3676	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	RegulatedBy Rv3223c	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008