Rv2718c - conserved hypothetical protein

Expression: Most Significant Conditions for Rv2718c

Protein Domains

Gene Information
Locus	Rv2718c
Symbol
Gene Name	conserved hypothetical protein
Location	3030413 - 3030877 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:465 bp Protein:155 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	728
Related Genes	Acel_1477 BL1312 CE1820 cg2112 DIP1424 jk1105 MAP2834c MAV_3612 Mkms_2216 ML1005 Mmcs_2170 MSMEG_2743 MT2791 MUL_3361 Mvan_2443 nfa37980 PPA1025 SAV2462
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv2718c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv2718c Transcript 1
MHCPFCRHPDSRVIDSRETDEGQAIRRRRSCPECGRRFTTVETAVLAVVKRSGVTEPFSR
EKVISGVRRACQGRQVDDDALNLLAQQVEDSVRAAGSPEIPSHDVGLAILGPLRELDEVA
YLRFASVYRSFSSADDFAREIEALRAHRNLSAHS*

Genomic Sequence

>Rv2718c
ATGCATTGCCCGTTCTGCCGGCATCCCGATTCGCGGGTGATCGATTCCCGGGAAACCGAT
GAAGGCCAGGCGATCCGGCGCCGGAGGTCGTGCCCCGAATGTGGACGACGATTCACCACC
GTAGAGACCGCGGTGCTGGCCGTAGTCAAGCGCAGTGGCGTTACCGAACCCTTCAGCAGG
GAAAAGGTGATCAGCGGTGTGCGCCGGGCGTGCCAGGGACGCCAGGTCGACGACGATGCG
TTGAACCTGCTGGCTCAGCAAGTCGAGGATTCGGTGCGTGCCGCGGGGTCGCCGGAGATT
CCGAGTCACGATGTCGGCCTGGCTATCCTGGGCCCGTTGCGCGAGCTTGACGAGGTGGCC
TACCTACGGTTCGCGTCGGTCTACCGGTCGTTTTCTTCCGCGGACGATTTCGCGCGCGAG
ATTGAGGCGCTTCGCGCGCACCGCAACCTATCAGCCCACAGCTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Transcription Rv2719c	active	ahal4789	2012-10-05
	operon(functional linkage) EM. Dullaghan, PC. Brooks et al. The role of multiple SOS boxes upstream of the Mycobacterium tuberculosis lexA gene--identification of a novel DNA-damage-inducible gene. Microbiology (Reading, Engl.) 2002
Interaction	Transcription Rv2719c	active	ahal4789	2012-10-05
	operon(functional linkage) EO. Davis, EM. Dullaghan et al. Definition of the mycobacterial SOS box and use to identify LexA-regulated genes in Mycobacterium tuberculosis. J. Bacteriol. 2002
Interaction	Transcription Rv2719c	active	ahal4789	2012-10-05
	operon(functional linkage) PC. Brooks, LF. Dawson et al. The mycobacterium-specific gene Rv2719c is DNA damage inducible independently of RecA. J. Bacteriol. 2006
Interaction	Transcription Rv2719c	active	ahal4789	2012-10-05
	operon(functional linkage) A. Chauhan, H. Lofton et al. Interference of Mycobacterium tuberculosis cell division by Rv2719c, a cell wall hydrolase. Mol. Microbiol. 2006
Interaction	Transcription Rv2717c	active	ahal4789	2012-10-05
	operon(functional linkage) authors,JJ. Villafranca,RS. Levy,J. Kernich,T. Vickroy TPN and Mn-isocitrate protect isocitrate dehydrogenase against inactivation but increase the number of modified sulfhydryl groups. Biochem. Biophys. Res. Commun. 1977
Interaction	Transcription Rv2719c	active	ahal4789	2012-10-05
	operon(functional linkage) authors,JJ. Villafranca,RS. Levy,J. Kernich,T. Vickroy TPN and Mn-isocitrate protect isocitrate dehydrogenase against inactivation but increase the number of modified sulfhydryl groups. Biochem. Biophys. Res. Commun. 1977
Interaction	Transcription Rv2717c	active	ahal4789	2012-10-05
	operon(functional linkage) authors,AP. Pugsley,P. Reeves Increased production of the outer membrane receptors for colicins B, D and M by Escherichia coli under iron starvation. Biochem. Biophys. Res. Commun. 1976
Interaction	Transcription Rv2719c	active	ahal4789	2012-10-05
	operon(functional linkage) authors,AP. Pugsley,P. Reeves Increased production of the outer membrane receptors for colicins B, D and M by Escherichia coli under iron starvation. Biochem. Biophys. Res. Commun. 1976
Interaction	Transcription Rv2717c	active	ahal4789	2012-10-05
	operon(functional linkage) authors,L. Wictorin,H. Fredriksson Microstructure of the solder-casting zone in bridges of dental gold alloys. Odontol Revy 1976
Interaction	Transcription Rv2719c	active	ahal4789	2012-10-05
	operon(functional linkage) authors,L. Wictorin,H. Fredriksson Microstructure of the solder-casting zone in bridges of dental gold alloys. Odontol Revy 1976
Interaction	Transcription Rv2717c	active	ahal4789	2012-10-05
	operon(functional linkage) MB. Mowa, DF. Warner et al. Function and regulation of class I ribonucleotide reductase-encoding genes in mycobacteria. J. Bacteriol. 2008
Interaction	Transcription Rv2719c	active	ahal4789	2012-10-05
	operon(functional linkage) MB. Mowa, DF. Warner et al. Function and regulation of class I ribonucleotide reductase-encoding genes in mycobacteria. J. Bacteriol. 2008
Interaction	Transcription Rv2717c	active	ahal4789	2012-10-05
	operon(functional linkage) PC. Brooks, LF. Dawson et al. The mycobacterium-specific gene Rv2719c is DNA damage inducible independently of RecA. J. Bacteriol. 2006
Interaction	Transcription Rv2719c	active	ahal4789	2012-10-05
	operon(functional linkage) PC. Brooks, LF. Dawson et al. The mycobacterium-specific gene Rv2719c is DNA damage inducible independently of RecA. J. Bacteriol. 2006
Interaction	Transcription Rv2717c	active	ahal4789	2012-10-05
	operon(functional linkage) A. Chauhan, H. Lofton et al. Interference of Mycobacterium tuberculosis cell division by Rv2719c, a cell wall hydrolase. Mol. Microbiol. 2006
Interaction	Transcription Rv2719c	active	ahal4789	2012-10-05
	operon(functional linkage) A. Chauhan, H. Lofton et al. Interference of Mycobacterium tuberculosis cell division by Rv2719c, a cell wall hydrolase. Mol. Microbiol. 2006
Interaction	Transcription Rv2717c	active	ahal4789	2012-10-05
	operon(functional linkage) authors,M. Ardenne,PG. Reitnauer [Demonstration of tumor inhibiting properties of a strongly immunostimulating low-molecular weight substance. Comparative studies with ifosfamide on the immuno-labile DS carcinosarcoma. Stimulation of the autoimmune activity for approx. 20 days by BA 1, a N-(2-cyanoethylene)-urea. Novel prophylactic possibilities]. Arzneimittelforschung 1975
Interaction	Transcription Rv2717c	active	ahal4789	2012-10-05
	operon(functional linkage) PC. Brooks, LF. Dawson et al. The mycobacterium-specific gene Rv2719c is DNA damage inducible independently of RecA. J. Bacteriol. 2006
Interaction	Transcription Rv2717c	active	ahal4789	2012-10-05
	operon(functional linkage) A. Chauhan, H. Lofton et al. Interference of Mycobacterium tuberculosis cell division by Rv2719c, a cell wall hydrolase. Mol. Microbiol. 2006