Rv2737c - recombination protein recA

Expression: Most Significant Conditions for Rv2737c

Protein Domains

Gene Information
Locus	Rv2737c
Symbol	recA
Gene Name	recombination protein recA
Location	3049052 - 3051424 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:2373 bp Protein:791 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	741
Related Genes	Acel_1492 BL1415 CE1849 cg2141 DIP1450 jk1116 MAP2848c MAV_3627 Mkms_2193 ML0987 Mmcs_2147 MSMEG_2723 MT2806 MUL_3380 Mvan_2420 nfa38430 PPA1012 SAV2492 SCO5769
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv2737c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv2737c Transcript 1
MTQTPDREKALELAVAQIEKSYGKGSVMRLGDEARQPISVIPTGSIALDVALGIGGLPRG
RVIEIYGPESSGKTTVALHAVANAQAAGGVAAFIDAEHALDPDYAKKLGVDTDSLLVSQP
DTGEQALEIADMLIRSGALDIVVIDSVAALVPRAELEGEMGDSHVGLQARLMSQALRKMT
GALNNSGTTAIFINQLRDKIGVMFGSPETTTGGKALKFYASVRMDVRRVETLKDGTNAVG
NRTRVKVVKNKCLAEGTRIFDPVTGTTHRIEDVVDGRKPIHVVAAAKDGTLHARPVVSWF
DQGTRDVIGLRIAGGAIVWATPDHKVLTEYGWRAAGELRKGDRVAQPRRFDGFGDSAPIP
ADHARLLGYLIGDGRDGWVGGKTPINFINVQRALIDDVTRIAATLGCAAHPQGRISLAIA
HRPGERNGVADLCQQAGIYGKLAWEKTIPNWFFEPDIAADIVGNLLFGLFESDGWVSREQ
TGALRVGYTTTSEQLAHQIHWLLLRFGVGSTVRDYDPTQKRPSIVNGRRIQSKRQVFEVR
ISGMDNVTAFAESVPMWGPRGAALIQAIPEATQGRRRGSQATYLAAEMTDAVLNYLDERG
VTAQEAAAMIGVASGDPRGGMKQVLGASRLRRDRVQALADALDDKFLHDMLAEELRYSVI
REVLPTRRARTFDLEVEELHTLVAEGVVVHNCSPPFKQAEFDILYGKGISREGSLIDMGV
DQGLIRKSGAWFTYEGEQLGQGKENARNFLVENADVADEIEKKIKEKLGIGAVVTDDPSN
DGVLPAPVDF*

Genomic Sequence

>Rv2737c
ATGACGCAGACCCCCGATCGGGAAAAGGCGCTCGAGCTGGCAGTGGCCCAGATCGAGAAG
AGTTACGGCAAAGGTTCGGTGATGCGCCTCGGCGACGAGGCGCGTCAGCCGATTTCGGTC
ATTCCGACCGGATCCATCGCACTAGACGTGGCCCTGGGCATTGGCGGCCTGCCGCGTGGC
CGGGTGATAGAGATATACGGCCCGGAGTCGTCGGGTAAGACCACCGTGGCGCTGCACGCG
GTGGCCAACGCTCAGGCCGCCGGTGGTGTTGCGGCGTTCATCGACGCCGAGCACGCGCTG
GATCCGGACTATGCCAAGAAGCTCGGTGTCGACACCGATTCGCTGCTGGTCAGCCAGCCG
GACACCGGGGAACAGGCACTCGAGATCGCCGACATGCTGATCCGCTCGGGTGCGCTTGAC
ATCGTGGTGATCGACTCGGTGGCGGCGCTGGTGCCGCGCGCGGAGCTCGAAGGCGAGATG
GGCGACAGCCACGTCGGGCTGCAGGCCCGGCTGATGAGCCAGGCGCTGCGGAAAATGACC
GGCGCGCTGAATAATTCGGGCACCACGGCGATCTTCATCAACCAGCTCCGCGACAAGATC
GGAGTGATGTTCGGGTCGCCCGAGACGACAACGGGCGGAAAGGCGTTGAAGTTCTACGCG
TCGGTGCGCATGGACGTGCGGCGAGTCGAGACGCTCAAGGACGGTACCAACGCGGTCGGC
AACCGCACCCGGGTCAAGGTCGTCAAGAACAAGTGCCTCGCAGAGGGCACTCGGATCTTC
GATCCGGTCACCGGTACAACGCATCGCATCGAGGATGTTGTCGATGGGCGCAAGCCTATT
CATGTCGTGGCTGCTGCCAAGGACGGAACGCTGCATGCGCGGCCCGTGGTGTCCTGGTTC
GACCAGGGAACGCGGGATGTGATCGGGTTGCGGATCGCCGGTGGCGCCATCGTGTGGGCG
ACACCCGATCACAAGGTGCTGACAGAGTACGGCTGGCGTGCCGCCGGGGAACTCCGCAAG
GGAGACAGGGTGGCGCAACCGCGACGCTTCGATGGATTCGGTGACAGTGCGCCGATTCCG
GCGGATCATGCCCGGCTGCTTGGCTACCTGATCGGAGATGGCAGGGATGGTTGGGTGGGG
GGCAAGACTCCGATCAACTTCATCAATGTTCAGCGGGCGCTCATTGACGACGTGACGCGA
ATCGCTGCGACGCTCGGTTGCGCGGCCCATCCGCAGGGGCGTATCTCACTCGCGATCGCT
CATCGACCCGGTGAGCGCAACGGTGTGGCAGACCTTTGTCAGCAGGCCGGTATCTACGGC
AAGCTCGCGTGGGAGAAGACGATTCCGAATTGGTTCTTCGAGCCGGACATCGCGGCCGAC
ATTGTCGGCAATCTGCTCTTCGGCCTGTTCGAAAGCGACGGGTGGGTGAGCCGGGAACAG
ACCGGGGCACTTCGGGTCGGTTACACGACGACCTCTGAACAACTCGCGCATCAGATTCAT
TGGCTGCTGCTGCGGTTCGGTGTCGGGAGCACCGTTCGAGATTACGATCCGACCCAGAAG
CGGCCGAGCATCGTCAACGGTCGACGGATCCAGAGCAAACGTCAAGTGTTCGAGGTCCGG
ATCTCGGGTATGGATAACGTCACGGCATTCGCGGAGTCAGTTCCCATGTGGGGGCCGCGC
GGTGCCGCGCTTATCCAGGCGATTCCAGAAGCCACGCAGGGGCGGCGTCGTGGATCGCAA
GCGACATATCTGGCTGCAGAGATGACCGATGCCGTGCTGAATTATCTGGACGAGCGCGGC
GTGACCGCGCAGGAGGCCGCGGCCATGATCGGTGTAGCTTCCGGGGACCCCCGCGGTGGA
ATGAAGCAGGTCTTAGGTGCCAGCCGCCTTCGTCGGGATCGCGTGCAGGCGCTCGCGGAT
GCCCTGGATGACAAATTCCTGCACGACATGCTGGCGGAAGAACTCCGCTATTCCGTGATC
CGAGAAGTGCTGCCAACGCGGCGGGCACGAACGTTCGACCTCGAGGTCGAGGAACTGCAC
ACCCTCGTCGCCGAAGGGGTTGTCGTGCACAACTGTTCGCCCCCCTTCAAGCAGGCCGAG
TTCGACATCCTCTACGGCAAGGGAATCAGCAGGGAGGGCTCGCTGATCGACATGGGTGTG
GATCAGGGCCTCATCCGCAAGTCGGGTGCCTGGTTCACCTACGAGGGCGAGCAGCTCGGC
CAGGGCAAGGAGAATGCCCGCAACTTCTTGGTGGAGAACGCCGACGTGGCTGACGAGATC
GAGAAGAAGATCAAGGAAAAGCTTGGCATTGGTGCCGTGGTGACCGATGATCCCTCAAAT
GACGGTGTCCTGCCCGCCCCCGTCGACTTCTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	PhysicalInteraction Rv2973c	active	shahanup86	2012-10-05
	Structural Analysis D. Schnappinger,S. Ehrt,MI. Voskuil,Y. Liu,JA. Mangan,IM. Monahan,G. Dolganov,B. Efron,PD. Butcher,C. Nathan,GK. Schoolnik Transcriptional Adaptation of Mycobacterium tuberculosis within Macrophages: Insights into the Phagosomal Environment. J. Exp. Med. 2003
Interaction	PhysicalInteraction Rv2973c	active	shahanup86	2012-10-05
	Structural Analysis authors,P. McGlynn,AA. Mahdi,RG. Lloyd Characterisation of the catalytically active form of RecG helicase. Nucleic Acids Res. 2000
Interaction	PhysicalInteraction Rv2973c	active	shahanup86	2012-10-05
	Structural Analysis authors,ME. Robu,RB. Inman,MM. Cox Situational repair of replication forks: roles of RecG and RecA proteins. J. Biol. Chem. 2004
Interaction	PhysicalInteraction Rv2973c	active	shahanup86	2012-10-05
	Structural Analysis authors,AV. Gregg,P. McGlynn,RP. Jaktaji,RG. Lloyd Direct rescue of stalled DNA replication forks via the combined action of PriA and RecG helicase activities. Mol. Cell 2002
Interaction	PhysicalInteraction Rv2973c	active	shahanup86	2012-10-05
	Structural Analysis authors,MR. Singleton,S. Scaife,DB. Wigley Structural analysis of DNA replication fork reversal by RecG. Cell 2001
Interaction	PhysicalInteraction Rv2973c	active	shahanup86	2012-10-05
	Structural Analysis authors,GJ. Sharples,SM. Ingleston,RG. Lloyd Holliday junction processing in bacteria: insights from the evolutionary conservation of RuvABC, RecG, and RusA. J. Bacteriol. 1999
Interaction	PhysicalInteraction Rv2973c	active	shahanup86	2012-10-05
	Spectrophotometric D. Schnappinger,S. Ehrt,MI. Voskuil,Y. Liu,JA. Mangan,IM. Monahan,G. Dolganov,B. Efron,PD. Butcher,C. Nathan,GK. Schoolnik Transcriptional Adaptation of Mycobacterium tuberculosis within Macrophages: Insights into the Phagosomal Environment. J. Exp. Med. 2003
Interaction	PhysicalInteraction Rv2973c	active	shahanup86	2012-10-05
	Spectrophotometric authors,P. McGlynn,AA. Mahdi,RG. Lloyd Characterisation of the catalytically active form of RecG helicase. Nucleic Acids Res. 2000
Interaction	PhysicalInteraction Rv2973c	active	shahanup86	2012-10-05
	Spectrophotometric authors,ME. Robu,RB. Inman,MM. Cox Situational repair of replication forks: roles of RecG and RecA proteins. J. Biol. Chem. 2004
Interaction	PhysicalInteraction Rv2973c	active	shahanup86	2012-10-05
	Spectrophotometric authors,AV. Gregg,P. McGlynn,RP. Jaktaji,RG. Lloyd Direct rescue of stalled DNA replication forks via the combined action of PriA and RecG helicase activities. Mol. Cell 2002
Interaction	PhysicalInteraction Rv2973c	active	shahanup86	2012-10-05
	Spectrophotometric authors,MR. Singleton,S. Scaife,DB. Wigley Structural analysis of DNA replication fork reversal by RecG. Cell 2001
Interaction	PhysicalInteraction Rv2973c	active	shahanup86	2012-10-05
	Spectrophotometric authors,GJ. Sharples,SM. Ingleston,RG. Lloyd Holliday junction processing in bacteria: insights from the evolutionary conservation of RuvABC, RecG, and RusA. J. Bacteriol. 1999
Interaction	PhysicalInteraction Rv2882c	active	priti.priety	2012-10-05
	Gene Neighbourhood K. Raman & N. Chandra Mycobacterium tuberculosis interactome analysis unravels potential pathways to drug resistance. BMC Microbiol. 2008
Interaction	PhysicalInteraction Rv2840c	active	akvsangli	2012-10-05
	authors,L. Cabusora,E. Sutton,A. Fulmer,CV. Forst Differential network expression during drug and stress response. Bioinformatics 2005
Interaction	Regulatory Rv2736c	active	balaganesh727	2012-10-05
	Co-expression (Functional linkage) V. Pagès, N. Koffel-Schwartz et al. recX, a new SOS gene that is co-transcribed with the recA gene in Escherichia coli. DNA Repair (Amst.) 2003
Interaction	Regulatory Rv2720	active	balaganesh727	2012-10-05
	Co-expression (Functional linkage) V. Pagès, N. Koffel-Schwartz et al. recX, a new SOS gene that is co-transcribed with the recA gene in Escherichia coli. DNA Repair (Amst.) 2003
Interaction	Regulatory Rv2736c	active	balaganesh727	2012-10-05
	Co-expression (Functional linkage) KG. Papavinasasundaram, F. Movahedzadeh et al. Mycobacterial recA is cotranscribed with a potential regulatory gene called recX. Mol. Microbiol. 1997
Interaction	Regulatory Rv2720	active	balaganesh727	2012-10-05
	Co-expression (Functional linkage) KG. Papavinasasundaram, F. Movahedzadeh et al. Mycobacterial recA is cotranscribed with a potential regulatory gene called recX. Mol. Microbiol. 1997
Interaction	Regulatory Rv2736c	active	balaganesh727	2012-10-05
	Co-expression (Functional linkage) L. Rand, J. Hinds et al. The majority of inducible DNA repair genes in Mycobacterium tuberculosis are induced independently of RecA. Mol. Microbiol. 2003
Interaction	Regulatory Rv2720	active	balaganesh727	2012-10-05
	Co-expression (Functional linkage) L. Rand, J. Hinds et al. The majority of inducible DNA repair genes in Mycobacterium tuberculosis are induced independently of RecA. Mol. Microbiol. 2003
Interaction	Regulatory Rv2736c	active	balaganesh727	2012-10-05
	Co-expression (Functional linkage) K. Raman & N. Chandra Mycobacterium tuberculosis interactome analysis unravels potential pathways to drug resistance. BMC Microbiol. 2008
Interaction	Regulatory Rv2720	active	balaganesh727	2012-10-05
	Co-expression (Functional linkage) K. Raman & N. Chandra Mycobacterium tuberculosis interactome analysis unravels potential pathways to drug resistance. BMC Microbiol. 2008
Interaction	Regulatory Rv2736c	active	balaganesh727	2012-10-05
	Co-expression (Functional linkage) V. Pagès, N. Koffel-Schwartz et al. recX, a new SOS gene that is co-transcribed with the recA gene in Escherichia coli. DNA Repair (Amst.) 2003
Interaction	Regulatory Rv2736c	active	balaganesh727	2012-10-05
	Co-expression (Functional linkage) KG. Papavinasasundaram, F. Movahedzadeh et al. Mycobacterial recA is cotranscribed with a potential regulatory gene called recX. Mol. Microbiol. 1997
Interaction	Regulatory Rv2720	active	ahal4789	2012-10-05
	Co-expression (Functional linkage) authors,C. Bridges-Webb Narcotic analgesics, addiction and endorphins. Med. J. Aust. 1979
Interaction	Regulatory Rv2720	active	ahal4789	2012-10-05
	Co-expression (Functional linkage) L. Rand, J. Hinds et al. The majority of inducible DNA repair genes in Mycobacterium tuberculosis are induced independently of RecA. Mol. Microbiol. 2003
Interaction	Regulatory Rv2720	active	ahal4789	2012-10-05
	Co-expression (Functional linkage) A. Chauhan, H. Lofton et al. Interference of Mycobacterium tuberculosis cell division by Rv2719c, a cell wall hydrolase. Mol. Microbiol. 2006
Interaction	Transcription Rv2016	active	sourish10	2012-10-05
	Co-occurrence (Functional linkage) V. Gamulin, H. Cetkovic et al. Identification of a promoter motif regulating the major DNA damage response mechanism of Mycobacterium tuberculosis. FEMS Microbiol. Lett. 2004
Interaction	Transcription Rv0823c	active	sourish10	2012-10-05
	Co-occurrence (Functional linkage) K. Raman & N. Chandra Mycobacterium tuberculosis interactome analysis unravels potential pathways to drug resistance. BMC Microbiol. 2008
Interaction	Regulatory Rv0823c	active	sourish10	2012-10-05
	Co-occurrence (Functional linkage) K. Raman & N. Chandra Mycobacterium tuberculosis interactome analysis unravels potential pathways to drug resistance. BMC Microbiol. 2008
Interaction	PhysicalInteraction Rv0003	active	singhpankaj2116	2012-10-05
	P. Singh, KN. Patil et al. Mycobacterium tuberculosis UvrD1 and UvrA Proteins Suppress DNA Strand Exchange Promoted by Cognate and Non-cognate RecA Proteins. Biochemistry 2010
Interaction	PhysicalInteraction Rv0003	active	singhpankaj2116	2012-10-05
	authors,V. Mizrahi,SJ. Andersen DNA repair in Mycobacterium tuberculosis. What have we learnt from the genome sequence? Mol. Microbiol. 1998
Interaction	RegulatedBy Rv2720	active	yamir.moreno	2012-10-05
	Homology search by authors. Human inference of consensus sequences (From MtbReglist). Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . Site-directed mutagenesis. A cis-mutation in the DNA sequence of the TF binding site interferes with the operation of the regulatory function.. Footprinting assay (DNase I, DMS, etc.). Physical binding of the regulator to the regulated promoter proved by using footprinting assay. authors,PE. Jacques,AL. Gervais,M. Cantin,JF. Lucier,G. Dallaire,G. Drouin,L. Gaudreau,J. Goulet,R. Brzezinski MtbRegList, a database dedicated to the analysis of transcriptional regulation in Mycobacterium tuberculosis. Bioinformatics 2005
Interaction	RegulatedBy Rv2720	active	yamir.moreno	2012-10-05
	Homology search by authors. Human inference of consensus sequences (From MtbReglist). Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . Site-directed mutagenesis. A cis-mutation in the DNA sequence of the TF binding site interferes with the operation of the regulatory function.. Footprinting assay (DNase I, DMS, etc.). Physical binding of the regulator to the regulated promoter proved by using footprinting assay. authors,PE. Jacques,AL. Gervais,M. Cantin,JF. Lucier,G. Dallaire,G. Drouin,L. Gaudreau,J. Goulet,R. Brzezinski MtbRegList, a database dedicated to the analysis of transcriptional regulation in Mycobacterium tuberculosis. Bioinformatics 2005
Interaction	RegulatedBy Rv2720	active	yamir.moreno	2012-10-05
	Homology search by authors. Human inference of consensus sequences (From MtbReglist). Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . Site-directed mutagenesis. A cis-mutation in the DNA sequence of the TF binding site interferes with the operation of the regulatory function.. Footprinting assay (DNase I, DMS, etc.). Physical binding of the regulator to the regulated promoter proved by using footprinting assay. authors,PE. Jacques,AL. Gervais,M. Cantin,JF. Lucier,G. Dallaire,G. Drouin,L. Gaudreau,J. Goulet,R. Brzezinski MtbRegList, a database dedicated to the analysis of transcriptional regulation in Mycobacterium tuberculosis. Bioinformatics 2005
Interaction	RegulatedBy Rv2720	active	yamir.moreno	2012-10-05
	Homology search by authors. Human inference of consensus sequences (From MtbReglist). Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . Site-directed mutagenesis. A cis-mutation in the DNA sequence of the TF binding site interferes with the operation of the regulatory function.. Footprinting assay (DNase I, DMS, etc.). Physical binding of the regulator to the regulated promoter proved by using footprinting assay. authors,PE. Jacques,AL. Gervais,M. Cantin,JF. Lucier,G. Dallaire,G. Drouin,L. Gaudreau,J. Goulet,R. Brzezinski MtbRegList, a database dedicated to the analysis of transcriptional regulation in Mycobacterium tuberculosis. Bioinformatics 2005
Interaction	RegulatedBy Rv2720	active	yamir.moreno	2012-10-05
	Homology search by authors. Human inference of consensus sequences (From MtbReglist). Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . Site-directed mutagenesis. A cis-mutation in the DNA sequence of the TF binding site interferes with the operation of the regulatory function.. Footprinting assay (DNase I, DMS, etc.). Physical binding of the regulator to the regulated promoter proved by using footprinting assay. EO. Davis, EM. Dullaghan et al. Definition of the mycobacterial SOS box and use to identify LexA-regulated genes in Mycobacterium tuberculosis. J. Bacteriol. 2002
Interaction	RegulatedBy Rv2720	active	yamir.moreno	2012-10-05
	Homology search by authors. Human inference of consensus sequences (From MtbReglist). Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . Site-directed mutagenesis. A cis-mutation in the DNA sequence of the TF binding site interferes with the operation of the regulatory function.. Footprinting assay (DNase I, DMS, etc.). Physical binding of the regulator to the regulated promoter proved by using footprinting assay. EO. Davis, EM. Dullaghan et al. Definition of the mycobacterial SOS box and use to identify LexA-regulated genes in Mycobacterium tuberculosis. J. Bacteriol. 2002
Interaction	RegulatedBy Rv2720	active	yamir.moreno	2012-10-05
	Homology search by authors. Human inference of consensus sequences (From MtbReglist). Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . Site-directed mutagenesis. A cis-mutation in the DNA sequence of the TF binding site interferes with the operation of the regulatory function.. Footprinting assay (DNase I, DMS, etc.). Physical binding of the regulator to the regulated promoter proved by using footprinting assay. EO. Davis, EM. Dullaghan et al. Definition of the mycobacterial SOS box and use to identify LexA-regulated genes in Mycobacterium tuberculosis. J. Bacteriol. 2002
Interaction	RegulatedBy Rv2720	active	yamir.moreno	2012-10-05
	Homology search by authors. Human inference of consensus sequences (From MtbReglist). Electrophoretic mobility shift assays EMSA. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . Site-directed mutagenesis. A cis-mutation in the DNA sequence of the TF binding site interferes with the operation of the regulatory function.. Footprinting assay (DNase I, DMS, etc.). Physical binding of the regulator to the regulated promoter proved by using footprinting assay. EO. Davis, EM. Dullaghan et al. Definition of the mycobacterial SOS box and use to identify LexA-regulated genes in Mycobacterium tuberculosis. J. Bacteriol. 2002
Interaction	RegulatedBy Rv2720	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	RegulatedBy Rv2720	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	RegulatedBy Rv2720	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. authors,M. Madan Babu,SA. Teichmann,L. Aravind Evolutionary dynamics of prokaryotic transcriptional regulatory networks. J. Mol. Biol. 2006
Other	TBPWY:Recombination repair	active	vmizrahi	2012-03-05