Rv2757c - conserved hypothetical protein

Expression: Most Significant Conditions for Rv2757c

Protein Domains

Gene Information
Locus	Rv2757c
Symbol
Gene Name	conserved hypothetical protein
Location	3070170 - 3070586 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:417 bp Protein:139 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	19213
Related Genes	MT2827
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv2757c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv2757c Transcript 1
MTTRYLLDKSAAYRAHLPAVRHRLEPLMERGLLARCGITDLEFGVSARSREDHRTLGTYR
RDALEYVNTPDTVWVRAWEIQEALTDKGFHRSVKIPDLIIAAVAEHHGIPVMHYDQDFER
IAAITRQPVEWVVAPGTA*

Genomic Sequence

>Rv2757c
ATGACCACGCGCTATTTGCTCGACAAATCAGCGGCTTACCGCGCGCACTTGCCCGCGGTC
CGACATCGCTTGGAACCGTTGATGGAACGCGGTCTACTGGCCCGGTGCGGCATTACCGAT
CTCGAGTTCGGAGTCTCGGCGCGTTCCCGCGAGGACCATCGAACACTGGGCACCTACCGG
CGTGACGCGCTCGAATACGTCAACACCCCCGACACCGTGTGGGTTCGTGCATGGGAGATC
CAAGAAGCATTGACCGACAAGGGATTTCACCGCTCGGTCAAGATCCCGGACTTGATCATT
GCGGCGGTCGCCGAGCATCACGGCATACCCGTCATGCACTACGACCAAGACTTCGAACGC
ATCGCCGCCATCACACGGCAACCCGTGGAATGGGTGGTGGCCCCAGGGACAGCGTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	InhibitedBy Rv2758c	active	vizhi.gurusamy	2012-10-05
	Co-expression (Functional linkage) authors,VL. Arcus,PB. Rainey,SJ. Turner The PIN-domain toxin-antitoxin array in mycobacteria. Trends Microbiol. 2005
Interaction	InhibitedBy Rv2758c	active	vizhi.gurusamy	2012-10-05
	Co-expression (Functional linkage) authors,DP. Pandey,K. Gerdes Toxin-antitoxin loci are highly abundant in free-living but lost from host-associated prokaryotes. Nucleic Acids Res. 2005
Interaction	InhibitedBy Rv2758c	active	vizhi.gurusamy	2012-10-05
	Co-expression (Functional linkage) authors,A. Gupta Killing activity and rescue function of genome-wide toxin-antitoxin loci of Mycobacterium tuberculosis. FEMS Microbiol. Lett. 2009
Interaction	InhibitedBy Rv2758c	active	vizhi.gurusamy	2012-10-05
	Co-expression (Functional linkage) authors,VL. Arcus,PB. Rainey,SJ. Turner The PIN-domain toxin-antitoxin array in mycobacteria. Trends Microbiol. 2005
Interaction	Regulatory Rv0616c	active	akankshajain.21	2012-10-05
	Co-expression (Functional linkage) T. Parish, DA. Smith et al. The senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. Microbiology (Reading, Engl.) 2003
Interaction	RegulatedBy Rv0491	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. T. Parish, DA. Smith et al. The senX3-regX3 two-component regulatory system of Mycobacterium tuberculosis is required for virulence. Microbiology (Reading, Engl.) 2003
Symbol	VapC21	active	jlew	2012-03-07
	We report the heterologous toxicity of these TA loci in Escherichia coli and show that only a few of the M. tuberculosis-encoded toxins can inhibit E. coli growth and have a killing effect. This killing effect can be suppressed by coexpression of the cognate antitoxin. authors,A. Gupta Killing activity and rescue function of genome-wide toxin-antitoxin loci of Mycobacterium tuberculosis. FEMS Microbiol. Lett. 2009
Other	strand:+	active	rslayden	2012-03-05
	MTCY63.06 (141 aa), FASTA scores: opt: 259, E(): 2.1e-11, (42.4% identity in 132 aa overlap); etc.
Other	stop:3070586	active	rslayden	2012-03-05
	MTCY63.06 (141 aa), FASTA scores: opt: 259, E(): 2.1e-11, (42.4% identity in 132 aa overlap); etc.
Other	start:3070170	active	rslayden	2012-03-05
	MTCY63.06 (141 aa), FASTA scores: opt: 259, E(): 2.1e-11, (42.4% identity in 132 aa overlap); etc.
Other	strand:+	active	rslayden	2012-03-05
	Rv0301
Other	stop:3070586	active	rslayden	2012-03-05
	Rv0301
Other	start:3070170	active	rslayden	2012-03-05
	Rv0301
Other	strand:+	active	rslayden	2012-03-05
	MTCY159.10c (137 aa), FASTA scores: opt: 265, E(): 7.5e-12, (38.5% identity in 135 aa overlap); O07228
Other	stop:3070586	active	rslayden	2012-03-05
	MTCY159.10c (137 aa), FASTA scores: opt: 265, E(): 7.5e-12, (38.5% identity in 135 aa overlap); O07228
Other	start:3070170	active	rslayden	2012-03-05
	MTCY159.10c (137 aa), FASTA scores: opt: 265, E(): 7.5e-12, (38.5% identity in 135 aa overlap); O07228
Other	strand:+	active	rslayden	2012-03-05
	Rv2546
Other	stop:3070586	active	rslayden	2012-03-05
	Rv2546
Other	start:3070170	active	rslayden	2012-03-05
	Rv2546
Other	strand:+	active	rslayden	2012-03-05
	MTCY08D5.24c (226 aa), FASTA scores: opt: 354, E():4.6e-18, (45.25% identity in 137 aa overlap) (N-terminus longer 89 aa); P95007
Other	stop:3070586	active	rslayden	2012-03-05
	MTCY08D5.24c (226 aa), FASTA scores: opt: 354, E():4.6e-18, (45.25% identity in 137 aa overlap) (N-terminus longer 89 aa); P95007
Other	start:3070170	active	rslayden	2012-03-05
	MTCY08D5.24c (226 aa), FASTA scores: opt: 354, E():4.6e-18, (45.25% identity in 137 aa overlap) (N-terminus longer 89 aa); P95007
Other	strand:+	active	rslayden	2012-03-05
	Rv0229c
Other	stop:3070586	active	rslayden	2012-03-05
	Rv0229c
Other	start:3070170	active	rslayden	2012-03-05
	Rv0229c
Other	strand:+	active	rslayden	2012-03-05
	Conserved hypothetical protein, similar to several other M. tuberculosis hypothetical proteins e.g. P96411
Other	stop:3070586	active	rslayden	2012-03-05
	Conserved hypothetical protein, similar to several other M. tuberculosis hypothetical proteins e.g. P96411
Other	start:3070170	active	rslayden	2012-03-05
	Conserved hypothetical protein, similar to several other M. tuberculosis hypothetical proteins e.g. P96411