Rv2928 - thioesterase tesA

Expression: Most Significant Conditions for Rv2928

Protein Domains

Gene Information
Locus	Rv2928
Symbol	tesA
Gene Name	thioesterase tesA
Location	3242198 - 3242983 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:786 bp Protein:262 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	22119
Related Genes	Mkms_2882 ML2359 Mmcs_2838 MT2998 MUL_2025 Mvan_3130
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv2928
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv2928 Transcript 1
MLARHGPRYGGSVNGHSDDSSGDAKQAAPTLYIFPHAGGTAKDYVAFSREFSADVKRIAV
QYPGQHDRSGLPPLESIPTLADEIFAMMKPSARIDDPVAFFGHSMGGMLAFEVALRYQSA
GHRVLAFFVSACSAPGHIRYKQLQDLSDREMLDLFTRMTGMNPDFFTDDEFFVGALPTLR
AVRAIAGYSCPPETKLSCPIYAFIGDKDWIATQDDMDPWRDRTTEEFSIRVFPGDHFYLN
DNLPELVSDIEDKTLQWHDRA*

Genomic Sequence

>Rv2928
ATGCTGGCCCGTCACGGACCACGCTATGGTGGCTCGGTGAACGGGCACTCAGACGACAGT
AGCGGCGACGCGAAGCAAGCCGCACCCACGCTGTATATTTTCCCGCATGCCGGCGGCACC
GCGAAAGACTATGTCGCATTTTCCCGAGAATTTTCCGCCGACGTAAAGCGGATTGCTGTC
CAATACCCCGGCCAGCACGATCGTTCTGGCCTGCCACCGCTTGAGAGTATTCCCACCCTC
GCTGACGAAATCTTTGCAATGATGAAACCGTCGGCTCGGATCGACGATCCGGTGGCATTC
TTTGGGCACAGTATGGGCGGAATGCTAGCCTTCGAAGTAGCGTTGCGATACCAATCGGCG
GGCCATCGAGTCCTGGCATTCTTTGTGTCGGCCTGCTCAGCACCGGGTCATATCAGATAC
AAGCAGCTCCAAGATTTATCAGATCGCGAGATGTTGGACTTGTTCACCCGAATGACAGGA
ATGAATCCAGATTTCTTTACCGACGACGAATTTTTCGTTGGAGCGCTACCCACGTTGCGA
GCGGTCCGAGCCATCGCCGGTTATTCCTGCCCACCAGAGACGAAGCTCTCGTGTCCGATT
TATGCCTTTATCGGAGATAAAGATTGGATCGCAACGCAAGACGACATGGATCCGTGGCGC
GATCGGACGACGGAAGAGTTCTCTATCCGTGTATTCCCTGGGGATCACTTCTACCTCAAC
GACAATTTGCCAGAGCTAGTCAGCGACATAGAAGACAAAACACTCCAATGGCATGATCGA
GCTTAG

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Term	TBRXN:PREPPACPH fatty-acyl-ACP hydrolase - IPI	active	njamshidi	2012-10-05
	for phthiocerol chain synthesis, see PMID: 15668773 A. Rao & A. Ranganathan Interaction studies on proteins encoded by the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Mol. Genet. Genomics 2004
Term	EC:3.1.2.14 Oleoyl-[acyl-carrier-protein] hydrolase. - IPI	active	njamshidi	2012-10-05
	for phthiocerol chain synthesis, see PMID: 15668773 A. Rao & A. Ranganathan Interaction studies on proteins encoded by the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Mol. Genet. Genomics 2004
Term	TBRXN:PREPPACPH fatty-acyl-ACP hydrolase - ISS	active	njamshidi	2012-10-05
	for phthiocerol chain synthesis, see PMID: 15668773 A. Rao & A. Ranganathan Interaction studies on proteins encoded by the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Mol. Genet. Genomics 2004
Term	EC:3.1.2.14 Oleoyl-[acyl-carrier-protein] hydrolase. - ISS	active	njamshidi	2012-10-05
	for phthiocerol chain synthesis, see PMID: 15668773 A. Rao & A. Ranganathan Interaction studies on proteins encoded by the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Mol. Genet. Genomics 2004
Term	TBRXN:PREPHACPH fatty-acyl-ACP hydrolase - IPI	active	njamshidi	2012-10-05
	for phthiocerol chain synthesis, see PMID: 15668773 A. Rao & A. Ranganathan Interaction studies on proteins encoded by the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Mol. Genet. Genomics 2004
Term	EC:3.1.2.14 Oleoyl-[acyl-carrier-protein] hydrolase. - IPI	active	njamshidi	2012-10-05
	for phthiocerol chain synthesis, see PMID: 15668773 A. Rao & A. Ranganathan Interaction studies on proteins encoded by the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Mol. Genet. Genomics 2004
Term	TBRXN:PREPHACPH fatty-acyl-ACP hydrolase - ISS	active	njamshidi	2012-10-05
	for phthiocerol chain synthesis, see PMID: 15668773 A. Rao & A. Ranganathan Interaction studies on proteins encoded by the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Mol. Genet. Genomics 2004
Term	EC:3.1.2.14 Oleoyl-[acyl-carrier-protein] hydrolase. - ISS	active	njamshidi	2012-10-05
	for phthiocerol chain synthesis, see PMID: 15668773 A. Rao & A. Ranganathan Interaction studies on proteins encoded by the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Mol. Genet. Genomics 2004
Interaction	PhysicalInteraction Rv2935	active	razeeth.new	2012-10-05
	two-hybrid (Physical interaction) authors,M. Jackson,G. Stadthagen,B. Gicquel Long-chain multiple methyl-branched fatty acid-containing lipids of Mycobacterium tuberculosis: biosynthesis, transport, regulation and biological activities. Tuberculosis (Edinb) 2007
Interaction	PhysicalInteraction Rv2935	active	razeeth.new	2012-10-05
	two-hybrid (Physical interaction) A. Rao & A. Ranganathan Interaction studies on proteins encoded by the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Mol. Genet. Genomics 2004
Interaction	RegulatedBy Rv0348	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. B. Abomoelak, EA. Hoye et al. mosR, a novel transcriptional regulator of hypoxia and virulence in Mycobacterium tuberculosis. J. Bacteriol. 2009
Name	Type II thioesterase thought to be involved in the release of phthiocerol and phenolphthiocerol from PpsE in the biosynthesis of phthiocerol dimycocerosates and phenolic glycolipids	active	mjackson	2012-10-05
	Phthiocerol dimycocerosates (PDIM), phenolic glycolipids (PGL) and para-hydroxybenzoic acid derivatives
Other	TBPWY:Phthiocerol dimycocerosates, PGL & pHBAD	active	mjackson	2012-03-05
	Type II thioesterase thought to be involved in the release of phthiocerol and phenolphthiocerol from PpsE in the biosynthesis of phthiocerol dimycocerosates and phenolic glycolipids (phenotypic [mycobacterial recombinant strains]) A. Rao & A. Ranganathan Interaction studies on proteins encoded by the phthiocerol dimycocerosate locus of Mycobacterium tuberculosis. Mol. Genet. Genomics 2004
Other	TBPWY:Phthiocerol dimycocerosates, PGL & pHBAD	active	mjackson	2012-03-05
	Type II thioesterase thought to be involved in the release of phthiocerol and phenolphthiocerol from PpsE in the biosynthesis of phthiocerol dimycocerosates and phenolic glycolipids (phenotypic [mycobacterial recombinant strains]) authors,L. Alibaud,Y. Rombouts,X. Trivelli,A. Burguière,SL. Cirillo,JD. Cirillo,JF. Dubremetz,Y. Guérardel,G. Lutfalla,L. Kremer A Mycobacterium marinum TesA mutant defective for major cell wall-associated lipids is highly attenuated in Dictyostelium discoideum and zebrafish embryos. Mol. Microbiol. 2011
Other	TBPWY:Phthiocerol dimycocerosates, PGL & pHBAD	active	mjackson	2012-03-05
	Type II thioesterase thought to be involved in the release of phthiocerol and phenolphthiocerol from PpsE in the biosynthesis of phthiocerol dimycocerosates and phenolic glycolipids (phenotypic [mycobacterial recombinant strains]) authors,SS. Chavadi,UR. Edupuganti,O. Vergnolle,I. Fatima,SM. Singh,CE. Soll,LE. Quadri Inactivation of tesA reduces cell wall lipid production and increases drug susceptibility in mycobacteria. J. Biol. Chem. 2011
Other	TBPWY:Phthiocerol dimycocerosates, PGL & pHBAD	active	mjackson	2012-03-05
	Type II thioesterase thought to be involved in the release of phthiocerol and phenolphthiocerol from PpsE in the biosynthesis of phthiocerol dimycocerosates and phenolic glycolipids (phenotypic [mycobacterial recombinant strains]) SJ. Waddell, GA. Chung et al. Inactivation of polyketide synthase and related genes results in the loss of complex lipids in Mycobacterium tuberculosis H37Rv. Lett. Appl. Microbiol. 2005