Rv2973c - ATP-dependent DNA helicase recG

Expression: Most Significant Conditions for Rv2973c

Protein Domains

Gene Information
Locus	Rv2973c
Symbol	recG
Gene Name	ATP-dependent DNA helicase recG
Location	3327733 - 3329946 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:2214 bp Protein:738 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	32757
Related Genes	Acel_1580 BL0329 CE1438 cg1498 DIP1136 jk1212 MAP3009c MAV_3818 Mkms_1982 ML1671 Mmcs_1936 MSMEG_2403 MT3051 MUL_1985 Mvan_2155 nfa41940 PPA1466 SAV2671
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv2973c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv2973c Transcript 1
MASLSDRLDRVLGATAADALDEQFGMRTVDDLLRHYPRSYVEGAARVGIGDARPEAGEHI
TIVDVITDTYSFPMKKKPNRKCLRITVGGGRNKVTATFFNADYIMRDLTKHTKVMLSGEV
GYYKGAMQLTHPAFLILDSPDGKNHGTRSLKSIADASKAISGELVVEEFERRFFPIYPAS
TKVQSWDIFKCVRQVLDVLDRVDDPLPAELRAKHGLIPEDEALRAIHLAESQSLRERARE
RLTFDEAVGLQWALVARRHGELSESGPSAAWKSNGLAAELLRRLPFELTAGQREVLDVLS
DGLAANRPLNRLLQGEVGSGKTIVAVLAMLQMVDAGYQCALLAPTEVLAAQHLRSIRDVL
GPLAMGGQLGGAENATRVALLTGSMTAGQKKQVRAEIASGQVGIVIGTHALLQEAVDFHN
LGMVVVDEQHRFGVEQRDQLRAKAPAGITPHLLVMTATPIPRTVALTVYGDLETSTLREL
PLGRQPIATNVIFVKDKPAWLDRAWRRIIEEAAAGRQAYVVAPRIDESDDTDVQGGVRPS
ATAEGLFSRLRSAELAELRLALMHGRLSADDKDAAMAAFRAGEVDVLVCTTVIEVGVDVP
NATVMLVMDADRFGISQLHQLRGRIGRGEHPSVCLLASWVPPDTPAGQRLRAVAGTMDGF
ALADLDLKERKEGDVLGRNQSGKAITLRLLSLAEHEEYIVAARDFCIEAYKNPTDPALAL
MAARFTSTDRIEYLDKS*

Genomic Sequence

>Rv2973c
GTGGCGTCGTTAAGCGATCGGCTCGATCGCGTCCTCGGCGCCACGGCAGCCGATGCCCTC
GACGAGCAGTTCGGCATGCGGACCGTCGACGACCTGCTCCGCCACTACCCGCGCAGCTAC
GTCGAGGGCGCGGCGCGGGTGGGTATCGGTGACGCGCGACCGGAAGCTGGCGAGCACATC
ACCATCGTCGACGTGATCACCGATACGTATTCGTTTCCGATGAAAAAGAAGCCGAATCGG
AAATGTCTGCGCATCACCGTCGGCGGCGGCCGCAACAAGGTGACGGCCACGTTCTTCAAC
GCGGACTACATCATGCGGGACCTCACCAAGCACACGAAGGTGATGCTCTCCGGGGAAGTC
GGCTACTACAAGGGCGCGATGCAGCTCACGCATCCGGCGTTTCTCATCCTCGACTCGCCG
GACGGGAAGAACCACGGCACCAGGTCGCTCAAAAGTATCGCTGATGCCTCCAAGGCCATC
AGCGGTGAATTGGTCGTGGAGGAGTTCGAGCGTCGTTTCTTCCCGATCTATCCGGCCAGC
ACAAAAGTGCAGAGCTGGGACATCTTCAAATGCGTGCGGCAGGTGCTCGATGTTCTCGAC
CGGGTCGATGATCCGTTGCCCGCGGAACTACGCGCCAAGCACGGCCTGATCCCCGAGGAC
GAGGCACTGCGCGCCATTCACCTTGCCGAAAGCCAGTCGTTACGCGAGCGCGCCCGGGAA
CGCCTGACCTTCGACGAGGCCGTGGGTCTGCAGTGGGCGCTGGTGGCCCGACGGCACGGT
GAACTGTCGGAATCCGGGCCCTCGGCGGCCTGGAAATCTAACGGTCTTGCCGCTGAGCTA
CTGCGGCGGTTGCCTTTTGAGCTGACGGCGGGACAGCGTGAGGTGCTCGACGTGTTGTCC
GACGGGCTCGCGGCGAACCGCCCGCTGAATCGCCTGCTGCAAGGCGAAGTGGGCTCGGGC
AAAACGATCGTTGCGGTGTTGGCGATGCTGCAGATGGTGGACGCGGGTTACCAGTGTGCC
CTGCTGGCGCCAACGGAAGTCCTTGCCGCACAACACTTGCGATCGATCCGCGATGTCCTA
GGGCCGCTGGCCATGGGCGGCCAACTGGGAGGCGCCGAAAACGCCACCCGGGTGGCACTG
CTCACCGGTTCGATGACGGCAGGGCAGAAGAAGCAAGTTCGCGCCGAAATCGCCAGCGGT
CAGGTCGGCATCGTCATCGGCACGCACGCGCTGCTGCAGGAGGCCGTCGACTTTCACAAC
CTGGGCATGGTGGTGGTCGACGAGCAACACCGGTTTGGTGTCGAGCAGCGAGATCAGTTG
CGCGCCAAGGCCCCCGCCGGCATTACCCCGCACCTGCTGGTGATGACCGCGACGCCGATA
CCGCGCACGGTCGCGCTGACCGTCTATGGCGACCTGGAAACCTCTACGCTGCGCGAACTT
CCGCTCGGGCGCCAGCCGATTGCCACCAACGTCATCTTTGTCAAGGACAAGCCCGCCTGG
CTCGACCGCGCCTGGCGGCGCATCATCGAAGAGGCTGCCGCCGGCCGCCAGGCCTATGTG
GTGGCGCCCCGCATCGATGAGTCCGACGACACCGACGTTCAAGGCGGCGTCCGACCATCG
GCCACTGCCGAAGGCCTGTTCTCCCGGTTGCGTTCCGCCGAGCTCGCAGAGTTGCGGTTG
GCGCTCATGCATGGACGGTTGTCGGCCGACGACAAGGACGCTGCGATGGCGGCTTTCCGG
GCCGGTGAGGTCGATGTGCTGGTGTGCACCACGGTCATTGAGGTTGGCGTCGATGTCCCC
AACGCTACGGTCATGCTGGTGATGGACGCCGACCGGTTCGGCATCAGCCAATTGCACCAG
CTGCGCGGCCGCATCGGGCGCGGCGAACATCCCAGCGTGTGTCTGCTGGCCAGCTGGGTG
CCGCCGGATACGCCGGCGGGTCAGCGGCTGCGTGCGGTCGCCGGGACAATGGACGGGTTC
GCCCTCGCCGATCTGGATCTGAAGGAGCGCAAGGAGGGAGATGTGCTGGGCCGCAACCAA
TCCGGCAAGGCCATCACGCTGCGGTTGCTGTCATTGGCCGAACACGAGGAATACATAGTG
GCCGCGCGGGACTTCTGCATCGAGGCTTACAAGAACCCCACAGACCCCGCATTGGCGCTG
ATGGCCGCGCGATTCACCAGCACCGACCGCATCGAATACTTAGATAAGTCATGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	PhysicalInteraction Rv1402	active	shahanup86	2012-10-05
	Structural Analysis D. Schnappinger,S. Ehrt,MI. Voskuil,Y. Liu,JA. Mangan,IM. Monahan,G. Dolganov,B. Efron,PD. Butcher,C. Nathan,GK. Schoolnik Transcriptional Adaptation of Mycobacterium tuberculosis within Macrophages: Insights into the Phagosomal Environment. J. Exp. Med. 2003
Interaction	PhysicalInteraction Rv2737c	active	shahanup86	2012-10-05
	Structural Analysis D. Schnappinger,S. Ehrt,MI. Voskuil,Y. Liu,JA. Mangan,IM. Monahan,G. Dolganov,B. Efron,PD. Butcher,C. Nathan,GK. Schoolnik Transcriptional Adaptation of Mycobacterium tuberculosis within Macrophages: Insights into the Phagosomal Environment. J. Exp. Med. 2003
Interaction	PhysicalInteraction Rv2594c	active	shahanup86	2012-10-05
	Structural Analysis D. Schnappinger,S. Ehrt,MI. Voskuil,Y. Liu,JA. Mangan,IM. Monahan,G. Dolganov,B. Efron,PD. Butcher,C. Nathan,GK. Schoolnik Transcriptional Adaptation of Mycobacterium tuberculosis within Macrophages: Insights into the Phagosomal Environment. J. Exp. Med. 2003
Interaction	PhysicalInteraction Rv2592c	active	shahanup86	2012-10-05
	Structural Analysis D. Schnappinger,S. Ehrt,MI. Voskuil,Y. Liu,JA. Mangan,IM. Monahan,G. Dolganov,B. Efron,PD. Butcher,C. Nathan,GK. Schoolnik Transcriptional Adaptation of Mycobacterium tuberculosis within Macrophages: Insights into the Phagosomal Environment. J. Exp. Med. 2003
Interaction	PhysicalInteraction Rv2593c	active	shahanup86	2012-10-05
	Structural Analysis D. Schnappinger,S. Ehrt,MI. Voskuil,Y. Liu,JA. Mangan,IM. Monahan,G. Dolganov,B. Efron,PD. Butcher,C. Nathan,GK. Schoolnik Transcriptional Adaptation of Mycobacterium tuberculosis within Macrophages: Insights into the Phagosomal Environment. J. Exp. Med. 2003
Interaction	PhysicalInteraction Rv1402	active	shahanup86	2012-10-05
	Structural Analysis authors,P. McGlynn,AA. Mahdi,RG. Lloyd Characterisation of the catalytically active form of RecG helicase. Nucleic Acids Res. 2000
Interaction	PhysicalInteraction Rv2737c	active	shahanup86	2012-10-05
	Structural Analysis authors,P. McGlynn,AA. Mahdi,RG. Lloyd Characterisation of the catalytically active form of RecG helicase. Nucleic Acids Res. 2000
Interaction	PhysicalInteraction Rv2594c	active	shahanup86	2012-10-05
	Structural Analysis authors,P. McGlynn,AA. Mahdi,RG. Lloyd Characterisation of the catalytically active form of RecG helicase. Nucleic Acids Res. 2000
Interaction	PhysicalInteraction Rv2592c	active	shahanup86	2012-10-05
	Structural Analysis authors,P. McGlynn,AA. Mahdi,RG. Lloyd Characterisation of the catalytically active form of RecG helicase. Nucleic Acids Res. 2000
Interaction	PhysicalInteraction Rv2593c	active	shahanup86	2012-10-05
	Structural Analysis authors,P. McGlynn,AA. Mahdi,RG. Lloyd Characterisation of the catalytically active form of RecG helicase. Nucleic Acids Res. 2000
Interaction	PhysicalInteraction Rv1402	active	shahanup86	2012-10-05
	Structural Analysis authors,ME. Robu,RB. Inman,MM. Cox Situational repair of replication forks: roles of RecG and RecA proteins. J. Biol. Chem. 2004
Interaction	PhysicalInteraction Rv2737c	active	shahanup86	2012-10-05
	Structural Analysis authors,ME. Robu,RB. Inman,MM. Cox Situational repair of replication forks: roles of RecG and RecA proteins. J. Biol. Chem. 2004
Interaction	PhysicalInteraction Rv2594c	active	shahanup86	2012-10-05
	Structural Analysis authors,ME. Robu,RB. Inman,MM. Cox Situational repair of replication forks: roles of RecG and RecA proteins. J. Biol. Chem. 2004
Interaction	PhysicalInteraction Rv2592c	active	shahanup86	2012-10-05
	Structural Analysis authors,ME. Robu,RB. Inman,MM. Cox Situational repair of replication forks: roles of RecG and RecA proteins. J. Biol. Chem. 2004
Interaction	PhysicalInteraction Rv2593c	active	shahanup86	2012-10-05
	Structural Analysis authors,ME. Robu,RB. Inman,MM. Cox Situational repair of replication forks: roles of RecG and RecA proteins. J. Biol. Chem. 2004
Interaction	PhysicalInteraction Rv1402	active	shahanup86	2012-10-05
	Structural Analysis authors,AV. Gregg,P. McGlynn,RP. Jaktaji,RG. Lloyd Direct rescue of stalled DNA replication forks via the combined action of PriA and RecG helicase activities. Mol. Cell 2002
Interaction	PhysicalInteraction Rv2737c	active	shahanup86	2012-10-05
	Structural Analysis authors,AV. Gregg,P. McGlynn,RP. Jaktaji,RG. Lloyd Direct rescue of stalled DNA replication forks via the combined action of PriA and RecG helicase activities. Mol. Cell 2002
Interaction	PhysicalInteraction Rv2594c	active	shahanup86	2012-10-05
	Structural Analysis authors,AV. Gregg,P. McGlynn,RP. Jaktaji,RG. Lloyd Direct rescue of stalled DNA replication forks via the combined action of PriA and RecG helicase activities. Mol. Cell 2002
Interaction	PhysicalInteraction Rv2592c	active	shahanup86	2012-10-05
	Structural Analysis authors,AV. Gregg,P. McGlynn,RP. Jaktaji,RG. Lloyd Direct rescue of stalled DNA replication forks via the combined action of PriA and RecG helicase activities. Mol. Cell 2002
Interaction	PhysicalInteraction Rv2593c	active	shahanup86	2012-10-05
	Structural Analysis authors,AV. Gregg,P. McGlynn,RP. Jaktaji,RG. Lloyd Direct rescue of stalled DNA replication forks via the combined action of PriA and RecG helicase activities. Mol. Cell 2002
Interaction	PhysicalInteraction Rv1402	active	shahanup86	2012-10-05
	Structural Analysis authors,MR. Singleton,S. Scaife,DB. Wigley Structural analysis of DNA replication fork reversal by RecG. Cell 2001
Interaction	PhysicalInteraction Rv2737c	active	shahanup86	2012-10-05
	Structural Analysis authors,MR. Singleton,S. Scaife,DB. Wigley Structural analysis of DNA replication fork reversal by RecG. Cell 2001
Interaction	PhysicalInteraction Rv2594c	active	shahanup86	2012-10-05
	Structural Analysis authors,MR. Singleton,S. Scaife,DB. Wigley Structural analysis of DNA replication fork reversal by RecG. Cell 2001
Interaction	PhysicalInteraction Rv2592c	active	shahanup86	2012-10-05
	Structural Analysis authors,MR. Singleton,S. Scaife,DB. Wigley Structural analysis of DNA replication fork reversal by RecG. Cell 2001
Interaction	PhysicalInteraction Rv2593c	active	shahanup86	2012-10-05
	Structural Analysis authors,MR. Singleton,S. Scaife,DB. Wigley Structural analysis of DNA replication fork reversal by RecG. Cell 2001
Interaction	PhysicalInteraction Rv1402	active	shahanup86	2012-10-05
	Structural Analysis authors,GJ. Sharples,SM. Ingleston,RG. Lloyd Holliday junction processing in bacteria: insights from the evolutionary conservation of RuvABC, RecG, and RusA. J. Bacteriol. 1999
Interaction	PhysicalInteraction Rv2737c	active	shahanup86	2012-10-05
	Structural Analysis authors,GJ. Sharples,SM. Ingleston,RG. Lloyd Holliday junction processing in bacteria: insights from the evolutionary conservation of RuvABC, RecG, and RusA. J. Bacteriol. 1999
Interaction	PhysicalInteraction Rv2594c	active	shahanup86	2012-10-05
	Structural Analysis authors,GJ. Sharples,SM. Ingleston,RG. Lloyd Holliday junction processing in bacteria: insights from the evolutionary conservation of RuvABC, RecG, and RusA. J. Bacteriol. 1999
Interaction	PhysicalInteraction Rv2592c	active	shahanup86	2012-10-05
	Structural Analysis authors,GJ. Sharples,SM. Ingleston,RG. Lloyd Holliday junction processing in bacteria: insights from the evolutionary conservation of RuvABC, RecG, and RusA. J. Bacteriol. 1999
Interaction	PhysicalInteraction Rv2593c	active	shahanup86	2012-10-05
	Structural Analysis authors,GJ. Sharples,SM. Ingleston,RG. Lloyd Holliday junction processing in bacteria: insights from the evolutionary conservation of RuvABC, RecG, and RusA. J. Bacteriol. 1999
Interaction	PhysicalInteraction Rv1402	active	shahanup86	2012-10-05
	Spectrophotometric D. Schnappinger,S. Ehrt,MI. Voskuil,Y. Liu,JA. Mangan,IM. Monahan,G. Dolganov,B. Efron,PD. Butcher,C. Nathan,GK. Schoolnik Transcriptional Adaptation of Mycobacterium tuberculosis within Macrophages: Insights into the Phagosomal Environment. J. Exp. Med. 2003
Interaction	PhysicalInteraction Rv2737c	active	shahanup86	2012-10-05
	Spectrophotometric D. Schnappinger,S. Ehrt,MI. Voskuil,Y. Liu,JA. Mangan,IM. Monahan,G. Dolganov,B. Efron,PD. Butcher,C. Nathan,GK. Schoolnik Transcriptional Adaptation of Mycobacterium tuberculosis within Macrophages: Insights into the Phagosomal Environment. J. Exp. Med. 2003
Interaction	PhysicalInteraction Rv2594c	active	shahanup86	2012-10-05
	Spectrophotometric D. Schnappinger,S. Ehrt,MI. Voskuil,Y. Liu,JA. Mangan,IM. Monahan,G. Dolganov,B. Efron,PD. Butcher,C. Nathan,GK. Schoolnik Transcriptional Adaptation of Mycobacterium tuberculosis within Macrophages: Insights into the Phagosomal Environment. J. Exp. Med. 2003
Interaction	PhysicalInteraction Rv2592c	active	shahanup86	2012-10-05
	Spectrophotometric D. Schnappinger,S. Ehrt,MI. Voskuil,Y. Liu,JA. Mangan,IM. Monahan,G. Dolganov,B. Efron,PD. Butcher,C. Nathan,GK. Schoolnik Transcriptional Adaptation of Mycobacterium tuberculosis within Macrophages: Insights into the Phagosomal Environment. J. Exp. Med. 2003
Interaction	PhysicalInteraction Rv2593c	active	shahanup86	2012-10-05
	Spectrophotometric D. Schnappinger,S. Ehrt,MI. Voskuil,Y. Liu,JA. Mangan,IM. Monahan,G. Dolganov,B. Efron,PD. Butcher,C. Nathan,GK. Schoolnik Transcriptional Adaptation of Mycobacterium tuberculosis within Macrophages: Insights into the Phagosomal Environment. J. Exp. Med. 2003
Interaction	PhysicalInteraction Rv1402	active	shahanup86	2012-10-05
	Spectrophotometric authors,P. McGlynn,AA. Mahdi,RG. Lloyd Characterisation of the catalytically active form of RecG helicase. Nucleic Acids Res. 2000
Interaction	PhysicalInteraction Rv2737c	active	shahanup86	2012-10-05
	Spectrophotometric authors,P. McGlynn,AA. Mahdi,RG. Lloyd Characterisation of the catalytically active form of RecG helicase. Nucleic Acids Res. 2000
Interaction	PhysicalInteraction Rv2594c	active	shahanup86	2012-10-05
	Spectrophotometric authors,P. McGlynn,AA. Mahdi,RG. Lloyd Characterisation of the catalytically active form of RecG helicase. Nucleic Acids Res. 2000
Interaction	PhysicalInteraction Rv2592c	active	shahanup86	2012-10-05
	Spectrophotometric authors,P. McGlynn,AA. Mahdi,RG. Lloyd Characterisation of the catalytically active form of RecG helicase. Nucleic Acids Res. 2000
Interaction	PhysicalInteraction Rv2593c	active	shahanup86	2012-10-05
	Spectrophotometric authors,P. McGlynn,AA. Mahdi,RG. Lloyd Characterisation of the catalytically active form of RecG helicase. Nucleic Acids Res. 2000
Interaction	PhysicalInteraction Rv1402	active	shahanup86	2012-10-05
	Spectrophotometric authors,ME. Robu,RB. Inman,MM. Cox Situational repair of replication forks: roles of RecG and RecA proteins. J. Biol. Chem. 2004
Interaction	PhysicalInteraction Rv2737c	active	shahanup86	2012-10-05
	Spectrophotometric authors,ME. Robu,RB. Inman,MM. Cox Situational repair of replication forks: roles of RecG and RecA proteins. J. Biol. Chem. 2004
Interaction	PhysicalInteraction Rv2594c	active	shahanup86	2012-10-05
	Spectrophotometric authors,ME. Robu,RB. Inman,MM. Cox Situational repair of replication forks: roles of RecG and RecA proteins. J. Biol. Chem. 2004
Interaction	PhysicalInteraction Rv2592c	active	shahanup86	2012-10-05
	Spectrophotometric authors,ME. Robu,RB. Inman,MM. Cox Situational repair of replication forks: roles of RecG and RecA proteins. J. Biol. Chem. 2004
Interaction	PhysicalInteraction Rv2593c	active	shahanup86	2012-10-05
	Spectrophotometric authors,ME. Robu,RB. Inman,MM. Cox Situational repair of replication forks: roles of RecG and RecA proteins. J. Biol. Chem. 2004
Interaction	PhysicalInteraction Rv1402	active	shahanup86	2012-10-05
	Spectrophotometric authors,AV. Gregg,P. McGlynn,RP. Jaktaji,RG. Lloyd Direct rescue of stalled DNA replication forks via the combined action of PriA and RecG helicase activities. Mol. Cell 2002
Interaction	PhysicalInteraction Rv2737c	active	shahanup86	2012-10-05
	Spectrophotometric authors,AV. Gregg,P. McGlynn,RP. Jaktaji,RG. Lloyd Direct rescue of stalled DNA replication forks via the combined action of PriA and RecG helicase activities. Mol. Cell 2002
Interaction	PhysicalInteraction Rv2594c	active	shahanup86	2012-10-05
	Spectrophotometric authors,AV. Gregg,P. McGlynn,RP. Jaktaji,RG. Lloyd Direct rescue of stalled DNA replication forks via the combined action of PriA and RecG helicase activities. Mol. Cell 2002
Interaction	PhysicalInteraction Rv2592c	active	shahanup86	2012-10-05
	Spectrophotometric authors,AV. Gregg,P. McGlynn,RP. Jaktaji,RG. Lloyd Direct rescue of stalled DNA replication forks via the combined action of PriA and RecG helicase activities. Mol. Cell 2002
Interaction	PhysicalInteraction Rv2593c	active	shahanup86	2012-10-05
	Spectrophotometric authors,AV. Gregg,P. McGlynn,RP. Jaktaji,RG. Lloyd Direct rescue of stalled DNA replication forks via the combined action of PriA and RecG helicase activities. Mol. Cell 2002
Interaction	PhysicalInteraction Rv1402	active	shahanup86	2012-10-05
	Spectrophotometric authors,MR. Singleton,S. Scaife,DB. Wigley Structural analysis of DNA replication fork reversal by RecG. Cell 2001
Interaction	PhysicalInteraction Rv2737c	active	shahanup86	2012-10-05
	Spectrophotometric authors,MR. Singleton,S. Scaife,DB. Wigley Structural analysis of DNA replication fork reversal by RecG. Cell 2001
Interaction	PhysicalInteraction Rv2594c	active	shahanup86	2012-10-05
	Spectrophotometric authors,MR. Singleton,S. Scaife,DB. Wigley Structural analysis of DNA replication fork reversal by RecG. Cell 2001
Interaction	PhysicalInteraction Rv2592c	active	shahanup86	2012-10-05
	Spectrophotometric authors,MR. Singleton,S. Scaife,DB. Wigley Structural analysis of DNA replication fork reversal by RecG. Cell 2001
Interaction	PhysicalInteraction Rv2593c	active	shahanup86	2012-10-05
	Spectrophotometric authors,MR. Singleton,S. Scaife,DB. Wigley Structural analysis of DNA replication fork reversal by RecG. Cell 2001
Interaction	PhysicalInteraction Rv1402	active	shahanup86	2012-10-05
	Spectrophotometric authors,GJ. Sharples,SM. Ingleston,RG. Lloyd Holliday junction processing in bacteria: insights from the evolutionary conservation of RuvABC, RecG, and RusA. J. Bacteriol. 1999
Interaction	PhysicalInteraction Rv2737c	active	shahanup86	2012-10-05
	Spectrophotometric authors,GJ. Sharples,SM. Ingleston,RG. Lloyd Holliday junction processing in bacteria: insights from the evolutionary conservation of RuvABC, RecG, and RusA. J. Bacteriol. 1999
Interaction	PhysicalInteraction Rv2594c	active	shahanup86	2012-10-05
	Spectrophotometric authors,GJ. Sharples,SM. Ingleston,RG. Lloyd Holliday junction processing in bacteria: insights from the evolutionary conservation of RuvABC, RecG, and RusA. J. Bacteriol. 1999
Interaction	PhysicalInteraction Rv2592c	active	shahanup86	2012-10-05
	Spectrophotometric authors,GJ. Sharples,SM. Ingleston,RG. Lloyd Holliday junction processing in bacteria: insights from the evolutionary conservation of RuvABC, RecG, and RusA. J. Bacteriol. 1999
Interaction	PhysicalInteraction Rv2593c	active	shahanup86	2012-10-05
	Spectrophotometric authors,GJ. Sharples,SM. Ingleston,RG. Lloyd Holliday junction processing in bacteria: insights from the evolutionary conservation of RuvABC, RecG, and RusA. J. Bacteriol. 1999
Other	TBPWY:Recombination repair	active	vmizrahi	2012-03-05
	Upregulated following infection of naýýve and activated mouse macrophages
Other	TBPWY:Recombination repair	active	vmizrahi	2012-03-05
	Increased expression in Mtb from clinical lung samples