Rv2987c - 3-isopropylmalate dehydratase small subunit leuD

Expression: Most Significant Conditions for Rv2987c

Protein Domains

Gene Information
Locus	Rv2987c
Symbol	leuD
Gene Name	3-isopropylmalate dehydratase small subunit leuD
Location	3344033 - 3344629 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:597 bp Protein:199 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	32754
Related Genes	Acel_1590 BL1263 CE1428 cg1488 DIP1128 jk1220 MAP3025c MAV_3837 Mkms_1968 ML1684 Mmcs_1922 MSMEG_2388 MT3065 MUL_1969 Mvan_2136 nfa42110 PPA1361 SAV2685 SCO5554
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv2987c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv2987c Transcript 1
MEAFHTHSGIGVPLRRSNVDTDQIIPAVFLKRVTRTGFEDGLFAGWRSDPAFVLNLSPFD
RGSVLVAGPDFGTGSSREHAVWALMDYGFRVVISSRFGDIFRGNAGKAGLLAAEVAQDDV
ELLWKLIEQSPGLEITANLQDRIITAATVVLPFKIDDHSAWRLLEGLDDIALTLRKLDEI
EAFEGACAYWKPRTLPAP*

Genomic Sequence

>Rv2987c
ATGGAAGCCTTTCACACCCACTCTGGTATTGGCGTGCCGTTGCGGCGGTCCAATGTCGAC
ACCGATCAGATCATTCCCGCGGTCTTTCTGAAGCGGGTCACCCGAACCGGTTTCGAGGAC
GGCTTGTTCGCGGGTTGGCGGTCGGATCCTGCATTCGTGCTAAACCTCAGTCCCTTTGAC
CGGGGTTCGGTCCTGGTTGCCGGGCCCGATTTCGGCACCGGATCCTCGCGAGAGCATGCG
GTCTGGGCGCTCATGGACTACGGATTCCGGGTGGTTATCTCATCCCGATTTGGTGACATT
TTCCGCGGCAACGCGGGCAAGGCCGGGCTGCTGGCGGCCGAGGTTGCCCAAGACGATGTG
GAACTCCTGTGGAAGCTCATTGAGCAGAGTCCGGGCCTGGAAATCACTGCCAATCTTCAA
GATCGAATTATCACCGCAGCAACAGTGGTGCTGCCGTTCAAGATTGACGACCACTCGGCG
TGGCGGCTGCTTGAAGGTCTCGACGATATAGCCCTTACGCTGCGGAAACTCGACGAGATC
GAGGCCTTTGAGGGTGCGTGCGCGTACTGGAAACCGCGCACTCTACCCGCCCCCTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	PhysicalInteraction Rv2988c	active	kholia.trupti	2012-10-05
	Structural Analysis M. Karuppasamy, A. Geerlof et al. Cloning, expression, purification, crystallization and preliminary X-ray diffraction analysis of the small subunit of isopropylmalate isomerase (Rv2987c) from Mycobacterium tuberculosis. Acta Crystallogr. Sect. F Struct. Biol. Cryst. Commun. 2009
Interaction	PhysicalInteraction Rv2988c	active	kholia.trupti	2012-10-05
	Structural Analysis N. Koon, CJ. Squire et al. Crystal structure of LeuA from Mycobacterium tuberculosis, a key enzyme in leucine biosynthesis. Proc. Natl. Acad. Sci. U.S.A. 2004
Interaction	PhysicalInteraction Rv2988c	active	kholia.trupti	2012-10-05
	Structural Analysis MK. Hondalus, S. Bardarov et al. Attenuation of and protection induced by a leucine auxotroph of Mycobacterium tuberculosis. Infect. Immun. 2000
Interaction	PhysicalInteraction Rv2988c	active	kholia.trupti	2012-10-05
	Spectrophotometric M. Karuppasamy, A. Geerlof et al. Cloning, expression, purification, crystallization and preliminary X-ray diffraction analysis of the small subunit of isopropylmalate isomerase (Rv2987c) from Mycobacterium tuberculosis. Acta Crystallogr. Sect. F Struct. Biol. Cryst. Commun. 2009
Interaction	PhysicalInteraction Rv2988c	active	kholia.trupti	2012-10-05
	Spectrophotometric N. Koon, CJ. Squire et al. Crystal structure of LeuA from Mycobacterium tuberculosis, a key enzyme in leucine biosynthesis. Proc. Natl. Acad. Sci. U.S.A. 2004
Interaction	PhysicalInteraction Rv2988c	active	kholia.trupti	2012-10-05
	Spectrophotometric MK. Hondalus, S. Bardarov et al. Attenuation of and protection induced by a leucine auxotroph of Mycobacterium tuberculosis. Infect. Immun. 2000
Interaction	RegulatedBy Rv0757	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. SB. Walters, E. Dubnau et al. The Mycobacterium tuberculosis PhoPR two-component system regulates genes essential for virulence and complex lipid biosynthesis. Mol. Microbiol. 2006
Interaction	RegulatedBy Rv3291c	active	yamir.moreno	2012-10-05
	E.coli orthology based inference. Orthologous pair regulator-target found in E.coli. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008