Rv3019c - Esat-6 like protein esxR

Expression: Most Significant Conditions for Rv3019c

Protein Domains

Gene Information
Locus	Rv3019c
Symbol	esxR
Gene Name	Esat-6 like protein esxR
Location	3378711 - 3379001 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:291 bp Protein:97 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	14073
Related Genes	MT3097 MT3104 MUL_2243 Rv3017c
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv3019c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv3019c Transcript 1
MSQIMYNYPAMMAHAGDMAGYAGTLQSLGADIASEQAVLSSAWQGDTGITYQGWQTQWNQ
ALEDLVRAYQSMSGTHESNTMAMLARDGAEAAKWGG*

Genomic Sequence

>Rv3019c
ATGTCGCAGATTATGTACAACTATCCGGCGATGATGGCTCATGCCGGGGACATGGCCGGT
TATGCGGGCACGCTGCAGAGCTTGGGGGCCGATATCGCCAGTGAGCAGGCCGTGCTGTCC
AGTGCTTGGCAGGGTGATACCGGGATCACGTATCAGGGCTGGCAGACCCAGTGGAACCAG
GCCCTAGAGGATCTGGTGCGGGCCTATCAGTCGATGTCTGGCACCCATGAGTCCAACACC
ATGGCGATGTTGGCTCGAGATGGGGCCGAAGCCGCCAAGTGGGGCGGCTAG

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Regulatory Rv2359	active	ilamathi.raja	2012-10-05
	Co-expression (Functional linkage) A. Maciag, A. Piazza et al. Transcriptional analysis of ESAT-6 cluster 3 in Mycobacterium smegmatis. BMC Microbiol. 2009
Interaction	Regulatory Rv2359	active	ilamathi.raja	2012-10-05
	Co-expression (Functional linkage) RL. Skjøt, I. Brock et al. Epitope mapping of the immunodominant antigen TB10.4 and the two homologous proteins TB10.3 and TB12.9, which constitute a subfamily of the esat-6 gene family. Infect. Immun. 2002
Interaction	RegulatedBy Rv2359	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008
Interaction	RegulatedBy Rv2711	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. GM. Rodriguez, MI. Voskuil et al. ideR, An essential gene in mycobacterium tuberculosis: role of IdeR in iron-dependent gene expression, iron metabolism, and oxidative stress response. Infect. Immun. 2002