Rv3088 - conserved hypothetical protein

Expression: Most Significant Conditions for Rv3088

Protein Domains

Gene Information
Locus	Rv3088
Symbol
Gene Name	conserved hypothetical protein
Location	3454340 - 3455764 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:1425 bp Protein:475 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	11795
Related Genes	MT3173 MUL_3162
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv3088
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv3088 Transcript 1
MTRINPIDLSFLLLERANRPNHMAAYTIFEKPKGQKSSFGPRLFDAYRHSQAAKPFNHKL
KWLGTDVAAWETVEPDMGYHIRHLALPAPGSMQQFHETVSFLNTGLLDRGHPMWECYIID
GIERGRIAILLKVHHALIDGEGGLRAMRNFLSDSPDDTTLAGPWMSAQGADRPRRTPATV
SRRAQLQGQLQGMIKGLTKLPSGLFGVSADAADLGAQALSLKARKASLPFTARRTLFNNT
AKSAARAYGNVELPLADVKALAKATGTSVNDVVMTVIDDALHHYLAEHQASTDRPLVAFM
PMSLREKSGEGGGNRVSAELVPMGAPKASPVERLKEINAATTRAKDKGRGMQTTSRQAYA
LLLLGSLTVADALPLLGKLPSANVVISNMKGPTEQLYLAGAPLVAFSGLPIVPPGAGLNV
TFASINTALCIAIGAAPEAVHEPSRLAELMQRAFTELQTEAGTTSPTTSKSRTP*

Genomic Sequence

>Rv3088
ATGACCCGCATCAATCCGATCGATCTGTCCTTCCTGCTGCTGGAGCGGGCCAACCGGCCC
AACCACATGGCCGCCTACACGATCTTCGAAAAGCCGAAAGGACAGAAATCGTCGTTCGGG
CCGCGCCTGTTCGATGCCTACCGGCACAGCCAGGCGGCCAAGCCCTTCAATCACAAGCTG
AAATGGCTGGGCACAGATGTTGCGGCGTGGGAAACCGTCGAGCCCGACATGGGCTATCAC
ATTCGACACCTCGCCCTGCCCGCACCGGGTTCCATGCAGCAGTTCCACGAAACGGTCTCG
TTCCTCAACACCGGCCTGCTCGATAGGGGCCACCCGATGTGGGAGTGCTACATCATCGAC
GGCATCGAGCGCGGCCGGATCGCGATCCTGCTCAAGGTGCACCACGCGCTCATCGACGGT
GAAGGCGGCCTGCGCGCGATGCGCAACTTCCTCTCCGATTCACCGGACGACACGACGCTG
GCCGGTCCCTGGATGTCGGCGCAGGGCGCCGACCGGCCACGGCGCACCCCCGCCACGGTG
TCGCGCAGGGCGCAACTGCAAGGACAACTGCAAGGAATGATCAAGGGGCTGACCAAGCTG
CCGAGCGGCCTGTTCGGCGTCAGCGCGGACGCGGCGGACCTTGGTGCGCAGGCACTGAGC
CTCAAGGCGCGCAAGGCGTCCCTGCCCTTCACGGCGCGACGCACTCTGTTCAACAACACG
GCGAAATCGGCGGCGCGCGCGTACGGGAACGTCGAGTTGCCGCTCGCCGACGTCAAGGCC
CTGGCCAAGGCGACCGGCACCTCGGTCAACGACGTGGTGATGACGGTCATCGACGACGCG
CTGCACCACTACCTCGCCGAACACCAGGCGTCCACCGACCGGCCGCTGGTGGCGTTCATG
CCGATGTCGCTGCGTGAGAAGTCGGGCGAGGGCGGTGGCAACCGGGTGAGCGCCGAACTG
GTCCCGATGGGTGCACCCAAGGCGAGTCCCGTTGAGCGCCTTAAGGAAATCAACGCGGCG
ACCACACGCGCGAAGGACAAAGGGCGCGGCATGCAAACGACGTCCCGCCAGGCCTACGCG
CTGCTACTGCTCGGCAGCCTGACGGTGGCGGACGCCCTGCCCCTGCTCGGCAAGTTGCCG
AGCGCGAATGTGGTGATATCAAACATGAAGGGGCCCACCGAGCAGCTCTACCTTGCCGGT
GCGCCGCTGGTGGCGTTCAGTGGCCTGCCCATCGTGCCGCCGGGCGCCGGGCTTAACGTC
ACCTTCGCCAGCATCAACACCGCGCTGTGCATCGCCATCGGCGCGGCACCGGAAGCCGTG
CACGAACCCTCCCGGCTGGCCGAACTGATGCAACGGGCATTCACCGAGCTCCAAACCGAA
GCCGGCACAACGAGTCCCACAACATCGAAGTCGAGAACCCCATGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Activation Rv3080c	active	sourish10	2012-10-05
	Structural Analysis P. Kumar, D. Kumar et al. The Mycobacterium tuberculosis protein kinase K modulates activation of transcription from the promoter of mycobacterial monooxygenase operon through phosphorylation of the transcriptional regulator VirS. J. Biol. Chem. 2009
Interaction	Activation Rv3080c	active	sourish10	2012-10-05
	Spectrophotometric P. Kumar, D. Kumar et al. The Mycobacterium tuberculosis protein kinase K modulates activation of transcription from the promoter of mycobacterial monooxygenase operon through phosphorylation of the transcriptional regulator VirS. J. Biol. Chem. 2009
Interaction	Transcription Rv3082c	active	sourish10	2012-10-05
	Co-expression (Functional linkage) A. Singh, S. Jain et al. mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. FEMS Microbiol. Lett. 2003
Interaction	Transcription Rv3089	active	sourish10	2012-10-05
	Operon (Functional linkage) A. Singh, S. Jain et al. mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. FEMS Microbiol. Lett. 2003
Interaction	Transcription Rv3085	active	sourish10	2012-10-05
	Operon (Functional linkage) A. Singh, S. Jain et al. mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. FEMS Microbiol. Lett. 2003
Interaction	Transcription Rv3087	active	sourish10	2012-10-05
	Operon (Functional linkage) A. Singh, S. Jain et al. mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. FEMS Microbiol. Lett. 2003
Interaction	Transcription Rv3086	active	sourish10	2012-10-05
	Operon (Functional linkage) A. Singh, S. Jain et al. mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. FEMS Microbiol. Lett. 2003
Interaction	Transcription Rv3084	active	sourish10	2012-10-05
	Operon (Functional linkage) A. Singh, S. Jain et al. mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. FEMS Microbiol. Lett. 2003
Interaction	Transcription Rv3083	active	sourish10	2012-10-05
	Operon (Functional linkage) A. Singh, S. Jain et al. mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. FEMS Microbiol. Lett. 2003
Interaction	Transcription Rv3085	active	sourish10	2012-10-05
	Co-expression (Functional linkage) A. Singh, S. Jain et al. mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. FEMS Microbiol. Lett. 2003
Interaction	Transcription Rv3084	active	sourish10	2012-10-05
	Co-expression (Functional linkage) A. Singh, S. Jain et al. mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. FEMS Microbiol. Lett. 2003
Interaction	Transcription Rv3083	active	priyadarshinipriyanka2001	2012-10-05
	Co-expression (Functional linkage) A. Singh, S. Jain et al. mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. FEMS Microbiol. Lett. 2003
Interaction	Transcription Rv3082c	active	priyadarshinipriyanka2001	2012-10-05
	Co-expression (Functional linkage) A. Singh, S. Jain et al. mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. FEMS Microbiol. Lett. 2003
Interaction	Transcription Rv3082c	active	priyadarshinipriyanka2001	2012-10-05
	Co-expression (Functional linkage) P. Kumar, D. Kumar et al. The Mycobacterium tuberculosis protein kinase K modulates activation of transcription from the promoter of mycobacterial monooxygenase operon through phosphorylation of the transcriptional regulator VirS. J. Biol. Chem. 2009
Interaction	Transcription Rv3082c	active	priyadarshinipriyanka2001	2012-10-05
	Co-expression (Functional linkage) A. Singh, R. Gupta et al. Requirement of the mymA operon for appropriate cell wall ultrastructure and persistence of Mycobacterium tuberculosis in the spleens of guinea pigs. J. Bacteriol. 2005
Interaction	RegulatedBy Rv3082c	active	yamir.moreno	2012-10-05
	LacZ-promoter fusion. expression levels of LacZ- regulated promoter fusion measured and compared between wild-type and trans-element mutation (knockout, over expression etc.). Gfp-promoter fusion. expression levels of gfp-regulated promoter fusion measured and compared between wild-type and trans-element mutation (knockout, over expression etc.). A. Singh, S. Jain et al. mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. FEMS Microbiol. Lett. 2003
Interaction	RegulatedBy Rv3082c	active	yamir.moreno	2012-10-05
	LacZ-promoter fusion. expression levels of LacZ- regulated promoter fusion measured and compared between wild-type and trans-element mutation (knockout, over expression etc.). Gfp-promoter fusion. expression levels of gfp-regulated promoter fusion measured and compared between wild-type and trans-element mutation (knockout, over expression etc.). A. Singh, S. Jain et al. mymA operon of Mycobacterium tuberculosis: its regulation and importance in the cell envelope. FEMS Microbiol. Lett. 2003
Name	Putative acyl CoA:diacylglycerol acyltransferase	active	mjackson	2012-10-05
	Triglyceride biosynthesis
Symbol	tgs4	active	mjackson	2012-10-05
	Triglyceride biosynthesis
Other	TBPWY:Triglyceride biosynthesis	active	mjackson	2012-03-05
	Putative acyl CoA:diacylglycerol acyltransferase (enzymatic) J. Daniel, C. Deb et al. Induction of a novel class of diacylglycerol acyltransferases and triacylglycerol accumulation in Mycobacterium tuberculosis as it goes into a dormancy-like state in culture. J. Bacteriol. 2004
Symbol	tgs4	active	mjackson	2012-03-05
	Putative acyl CoA:diacylglycerol acyltransferase (enzymatic) J. Daniel, C. Deb et al. Induction of a novel class of diacylglycerol acyltransferases and triacylglycerol accumulation in Mycobacterium tuberculosis as it goes into a dormancy-like state in culture. J. Bacteriol. 2004