Rv3132c - two component system sensor histidine kinase devS

Expression: Most Significant Conditions for Rv3132c

Protein Domains

Gene Information
Locus	Rv3132c
Symbol	devS
Gene Name	two component system sensor histidine kinase devS
Location	3497529 - 3499265 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:1737 bp Protein:579 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	31584
Related Genes	Mkms_4200 Mmcs_4125 MSMEG_5241 MT3218 MUL_2422
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv3132c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv3132c Transcript 1
MTTGGLVDENDGAAMRPLRHTLSQLRLHELLVEVQDRVEQIVEGRDRLDGLVEAMLVVTA
GLDLEATLRAIVHSATSLVDARYGAMEVHDRQHRVLHFVYEGIDEETVRRIGHLPKGLGV
IGLLIEDPKPLRLDDVSAHPASIGFPPYHPPMRTFLGVPVRVRDESFGTLYLTDKTNGQP
FSDDDEVLVQALAAAAGIAVANARLYQQAKARQSWIEATRDIATELLSGTEPATVFRLVA
AEALKLTAADAALVAVPVDEDMPAADVGELLVIETVGSAVASIVGRTIPVAGAVLREVFV
NGIPRRVDRVDLEGLDELADAGPALLLPLRARGTVAGVVVVLSQGGPGAFTDEQLEMMAA
FADQAALAWQLATSQRRMRELDVLTDRDRIARDLHDHVIQRLFAIGLALQGAVPHERNPE
VQQRLSDVVDDLQDVIQEIRTTIYDLHGASQGITRLRQRIDAAVAQFADSGLRTSVQFVG
PLSVVDSALADQAEAVVREAVSNAVRHAKASTLTVRVKVDDDLCIEVTDNGRGLPDEFTG
SGLTNLRQRAEQAGGEFTLASVPGASGTVLRWSAPLSQ*

Genomic Sequence

>Rv3132c
ATGACAACAGGGGGCCTCGTCGACGAAAACGACGGCGCCGCAATGCGTCCACTGCGTCAC
ACGCTCTCCCAACTACGCCTGCACGAGCTGCTGGTCGAGGTGCAGGACCGGGTCGAGCAG
ATCGTCGAGGGCCGGGACCGCCTCGATGGTCTGGTGGAGGCCATGCTCGTGGTCACAGCG
GGCCTGGACCTGGAGGCAACCCTACGCGCTATCGTGCATTCAGCGACCAGCCTTGTCGAT
GCGCGCTATGGCGCTATGGAGGTGCACGACCGGCAGCATCGGGTATTGCACTTTGTCTAT
GAAGGCATCGACGAGGAGACCGTTCGGCGGATCGGCCACCTACCGAAAGGCCTAGGCGTC
ATCGGGCTGCTCATCGAAGATCCCAAACCGTTACGGCTGGACGATGTTTCTGCGCACCCG
GCCTCGATTGGTTTTCCGCCGTATCATCCGCCGATGCGTACCTTCCTCGGGGTACCGGTT
CGGGTGCGCGATGAATCGTTCGGCACTCTGTACCTGACTGACAAGACCAACGGGCAACCG
TTCAGCGACGACGACGAGGTTCTGGTCCAGGCGCTGGCGGCCGCCGCGGGTATCGCAGTC
GCGAATGCCCGGCTCTACCAGCAGGCTAAGGCGCGTCAGTCGTGGATCGAGGCCACCCGT
GACATCGCCACCGAGTTGTTGTCCGGCACCGAACCCGCGACGGTGTTCCGGCTTGTCGCC
GCGGAGGCGCTCAAGCTGACGGCGGCTGACGCTGCCCTGGTAGCCGTTCCCGTCGACGAG
GACATGCCTGCCGCTGACGTGGGGGAGCTGCTGGTGATTGAAACAGTCGGCAGCGCTGTG
GCTTCCATTGTTGGGCGAACGATTCCGGTGGCGGGCGCGGTGCTGCGGGAGGTCTTCGTC
AACGGCATTCCGCGACGGGTCGACCGGGTCGATTTGGAAGGCCTGGACGAACTGGCCGAC
GCAGGTCCGGCGCTGCTGTTGCCGCTGCGGGCCAGAGGTACCGTAGCGGGTGTCGTTGTT
GTGCTGAGTCAAGGCGGTCCAGGGGCTTTCACCGACGAACAACTCGAGATGATGGCCGCG
TTCGCCGACCAGGCCGCGCTGGCTTGGCAATTGGCCACTTCGCAACGTCGGATGCGCGAA
CTCGACGTACTGACCGACCGGGATCGTATCGCCCGTGACCTCCATGACCATGTCATCCAG
CGGCTCTTCGCGATTGGCCTGGCTTTGCAGGGTGCTGTCCCGCACGAACGTAATCCTGAA
GTGCAGCAACGACTCTCGGACGTGGTAGACGATCTGCAAGACGTTATACAGGAAATCCGG
ACCACCATTTATGACCTGCACGGAGCATCGCAGGGTATCACTCGGCTCCGGCAGCGAATC
GATGCGGCCGTAGCCCAATTTGCCGACTCGGGGTTGCGCACCAGCGTTCAATTCGTGGGT
CCATTGTCGGTGGTCGACAGCGCGCTCGCCGATCAGGCCGAGGCGGTGGTTCGGGAAGCG
GTCAGCAACGCGGTTCGCCATGCGAAGGCCAGCACGTTGACCGTCCGGGTCAAAGTCGAC
GACGACTTGTGCATCGAGGTGACCGACAACGGCCGCGGGCTGCCCGACGAGTTCACCGGA
AGCGGCTTAACGAACCTGCGGCAGCGGGCAGAGCAGGCCGGCGGCGAATTCACCCTCGCG
AGCGTACCGGGCGCGAGCGGAACAGTGCTGCGATGGTCAGCACCGTTGTCGCAGTAG

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	PhysicalInteraction Rv3134c	active	kaveri.verma	2012-10-05
	Affinity purification (Physical interaction) G. Bagchi, null. Mayuri et al. Hypoxia-responsive expression of Mycobacterium tuberculosis Rv3134c and devR promoters in Mycobacterium smegmatis. Microbiology (Reading, Engl.) 2003
Interaction	PhysicalInteraction Rv3134c	active	kaveri.verma	2012-10-05
	Affinity purification (Physical interaction) JG. Rodriguez, CS. Burbano et al. Rv3134c/devR/devS operon of Mycobacterium bovis BCG is differentially transcribed under "in vitro" stress conditions. Tuberculosis (Edinburgh, Scotland) 2008
Interaction	PhysicalInteraction Rv3134c	active	kaveri.verma	2012-10-05
	Affinity purification (Physical interaction) PJ. Converse, PC. Karakousis et al. The role of the dosR/dosS two-component regulatory system in Mycobacterium tuberculosis virulence in three animal models. Infect. Immun. 2008
Interaction	PhysicalInteraction Rv3134c	active	kaveri.verma	2012-10-05
	Affinity purification (Physical interaction) null. Mayuri, G. Bagchi et al. Molecular analysis of the dormancy response in Mycobacterium smegmatis: expression analysis of genes encoding the DevR-DevS two-component system, Rv3134c and chaperone alpha-crystallin homologues. FEMS Microbiol. Lett. 2002
Interaction	PhysicalInteraction Rv3134c	active	kaveri.verma	2012-10-05
	Affinity purification (Physical interaction) S. Chauhan & JS. Tyagi Cooperative binding of phosphorylated DevR to upstream sites is necessary and sufficient for activation of the Rv3134c-devRS operon in Mycobacterium tuberculosis: implication in the induction of DevR target genes. J. Bacteriol. 2008
Interaction	Regulatory Rv3133c	active	jhum4u2006	2012-10-05
	Co-occurrence (Functional linkage) A. Kumar,JC. Toledo,RP. Patel,JR. Lancaster,AJ. Steyn Mycobacterium tuberculosis DosS is a redox sensor and DosT is a hypoxia sensor. Proc. Natl. Acad. Sci. U.S.A. 2007
Interaction	Regulatory Rv3133c	active	jhum4u2006	2012-10-05
	Co-occurrence (Functional linkage) EH. Sousa, JR. Tuckerman et al. DosT and DevS are oxygen-switched kinases in Mycobacterium tuberculosis. Protein Sci. 2007
Interaction	Regulatory Rv3133c	active	jhum4u2006	2012-10-05
	Co-occurrence (Functional linkage) S. Sardiwal,SL. Kendall,F. Movahedzadeh,SC. Rison,NG. Stoker,S. Djordjevic A GAF domain in the hypoxia/NO-inducible Mycobacterium tuberculosis DosS protein binds haem. J. Mol. Biol. 2005
Interaction	Regulatory Rv3133c	active	jhum4u2006	2012-10-05
	Co-occurrence (Functional linkage) DK. Saini, V. Malhotra et al. DevR-DevS is a bona fide two-component system of Mycobacterium tuberculosis that is hypoxia-responsive in the absence of the DNA-binding domain of DevR. Microbiology (Reading, Engl.) 2004
Interaction	Regulatory Rv3133c	active	jhum4u2006	2012-10-05
	Co-occurrence (Functional linkage) DM. Roberts, RP. Liao et al. Two sensor kinases contribute to the hypoxic response of Mycobacterium tuberculosis. J. Biol. Chem. 2004
Interaction	Regulatory Rv3133c	active	jhum4u2006	2012-10-05
	Co-occurrence (Functional linkage) authors,S. Gu,J. Chen,KM. Dobos,EM. Bradbury,JT. Belisle,X. Chen Comprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain. Mol. Cell Proteomics 2003
Interaction	Regulatory Rv3133c	active	jhum4u2006	2012-10-05
	Co-occurrence (Functional linkage) MI. Voskuil, D. Schnappinger et al. Inhibition of respiration by nitric oxide induces a Mycobacterium tuberculosis dormancy program. J. Exp. Med. 2003
Interaction	Regulatory Rv3133c	active	jhum4u2006	2012-10-05
	Co-occurrence (Functional linkage) HD. Park, KM. Guinn et al. Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. Mol. Microbiol. 2003
Interaction	Regulatory Rv3133c	active	jhum4u2006	2012-10-05
	Co-occurrence (Functional linkage) DK. Saini, N. Pant et al. Cloning, overexpression, purification, and matrix-assisted refolding of DevS (Rv 3132c) histidine protein kinase of Mycobacterium tuberculosis. Protein Expr. Purif. 2002
Interaction	Regulatory Rv3133c	active	jhum4u2006	2012-10-05
	Co-occurrence (Functional linkage) null. Mayuri, G. Bagchi et al. Molecular analysis of the dormancy response in Mycobacterium smegmatis: expression analysis of genes encoding the DevR-DevS two-component system, Rv3134c and chaperone alpha-crystallin homologues. FEMS Microbiol. Lett. 2002
Interaction	Regulatory Rv3133c	active	jhum4u2006	2012-10-05
	Co-occurrence (Functional linkage) authors,JC. Betts,PT. Lukey,LC. Robb,RA. McAdam,K. Duncan Evaluation of a nutrient starvation model of Mycobacterium tuberculosis persistence by gene and protein expression profiling. Mol. Microbiol. 2002
Interaction	Regulatory Rv3133c	active	jhum4u2006	2012-10-05
	Co-occurrence (Functional linkage) N. Dasgupta, V. Kapur et al. Characterization of a two-component system, devR-devS, of Mycobacterium tuberculosis. Tuber. Lung Dis. 2000
Interaction	Regulatory Rv3133c	active	jhum4u2006	2012-10-05
	Co-occurrence (Functional linkage) DR. Sherman, M. Voskuil et al. Regulation of the Mycobacterium tuberculosis hypoxic response gene encoding alpha -crystallin. Proc. Natl. Acad. Sci. U.S.A. 2001
Interaction	Regulatory Rv3133c	active	jhum4u2006	2012-10-05
	Co-occurrence (Functional linkage) PJ. Converse, PC. Karakousis et al. The role of the dosR/dosS two-component regulatory system in Mycobacterium tuberculosis virulence in three animal models. Infect. Immun. 2008
Interaction	Regulatory Rv3133c	active	jhum4u2006	2012-10-05
	Co-occurrence (Functional linkage) HY. Cho,HJ. Cho,YM. Kim,JI. Oh,BS. Kang Structural insight into the heme-based redox sensing by DosS from Mycobacterium tuberculosis. J. Biol. Chem. 2009
Interaction	Regulatory Rv3133c	active	hibeeluck	2012-10-05
	Co-occurrence (Functional linkage) A. Kumar,JC. Toledo,RP. Patel,JR. Lancaster,AJ. Steyn Mycobacterium tuberculosis DosS is a redox sensor and DosT is a hypoxia sensor. Proc. Natl. Acad. Sci. U.S.A. 2007
Interaction	Regulatory Rv3133c	active	hibeeluck	2012-10-05
	Co-occurrence (Functional linkage) EH. Sousa, JR. Tuckerman et al. DosT and DevS are oxygen-switched kinases in Mycobacterium tuberculosis. Protein Sci. 2007
Interaction	Regulatory Rv3133c	active	hibeeluck	2012-10-05
	Co-occurrence (Functional linkage) S. Sardiwal,SL. Kendall,F. Movahedzadeh,SC. Rison,NG. Stoker,S. Djordjevic A GAF domain in the hypoxia/NO-inducible Mycobacterium tuberculosis DosS protein binds haem. J. Mol. Biol. 2005
Interaction	Regulatory Rv3133c	active	hibeeluck	2012-10-05
	Co-occurrence (Functional linkage) DK. Saini, V. Malhotra et al. DevR-DevS is a bona fide two-component system of Mycobacterium tuberculosis that is hypoxia-responsive in the absence of the DNA-binding domain of DevR. Microbiology (Reading, Engl.) 2004
Interaction	Regulatory Rv3133c	active	hibeeluck	2012-10-05
	Co-occurrence (Functional linkage) DM. Roberts, RP. Liao et al. Two sensor kinases contribute to the hypoxic response of Mycobacterium tuberculosis. J. Biol. Chem. 2004
Interaction	Regulatory Rv3133c	active	hibeeluck	2012-10-05
	Co-occurrence (Functional linkage) authors,S. Gu,J. Chen,KM. Dobos,EM. Bradbury,JT. Belisle,X. Chen Comprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain. Mol. Cell Proteomics 2003
Interaction	Regulatory Rv3133c	active	hibeeluck	2012-10-05
	Co-occurrence (Functional linkage) MI. Voskuil, D. Schnappinger et al. Inhibition of respiration by nitric oxide induces a Mycobacterium tuberculosis dormancy program. J. Exp. Med. 2003
Interaction	Regulatory Rv3133c	active	hibeeluck	2012-10-05
	Co-occurrence (Functional linkage) HD. Park, KM. Guinn et al. Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. Mol. Microbiol. 2003
Interaction	Regulatory Rv3133c	active	hibeeluck	2012-10-05
	Co-occurrence (Functional linkage) DK. Saini, N. Pant et al. Cloning, overexpression, purification, and matrix-assisted refolding of DevS (Rv 3132c) histidine protein kinase of Mycobacterium tuberculosis. Protein Expr. Purif. 2002
Interaction	Regulatory Rv3133c	active	hibeeluck	2012-10-05
	Co-occurrence (Functional linkage) null. Mayuri, G. Bagchi et al. Molecular analysis of the dormancy response in Mycobacterium smegmatis: expression analysis of genes encoding the DevR-DevS two-component system, Rv3134c and chaperone alpha-crystallin homologues. FEMS Microbiol. Lett. 2002
Interaction	Regulatory Rv3133c	active	hibeeluck	2012-10-05
	Co-occurrence (Functional linkage) authors,JC. Betts,PT. Lukey,LC. Robb,RA. McAdam,K. Duncan Evaluation of a nutrient starvation model of Mycobacterium tuberculosis persistence by gene and protein expression profiling. Mol. Microbiol. 2002
Interaction	Regulatory Rv3133c	active	hibeeluck	2012-10-05
	Co-occurrence (Functional linkage) N. Dasgupta, V. Kapur et al. Characterization of a two-component system, devR-devS, of Mycobacterium tuberculosis. Tuber. Lung Dis. 2000
Interaction	Regulatory Rv3133c	active	hibeeluck	2012-10-05
	Co-occurrence (Functional linkage) DR. Sherman, M. Voskuil et al. Regulation of the Mycobacterium tuberculosis hypoxic response gene encoding alpha -crystallin. Proc. Natl. Acad. Sci. U.S.A. 2001
Interaction	Regulatory Rv3133c	active	hibeeluck	2012-10-05
	Co-occurrence (Functional linkage) PJ. Converse, PC. Karakousis et al. The role of the dosR/dosS two-component regulatory system in Mycobacterium tuberculosis virulence in three animal models. Infect. Immun. 2008
Interaction	Regulatory Rv3133c	active	hibeeluck	2012-10-05
	Co-occurrence (Functional linkage) HY. Cho,HJ. Cho,YM. Kim,JI. Oh,BS. Kang Structural insight into the heme-based redox sensing by DosS from Mycobacterium tuberculosis. J. Biol. Chem. 2009
Interaction	Regulatory Rv3133c	active	jhum4u2006	2012-10-05
	Affinity purification (Physical interaction) A. Kumar,JC. Toledo,RP. Patel,JR. Lancaster,AJ. Steyn Mycobacterium tuberculosis DosS is a redox sensor and DosT is a hypoxia sensor. Proc. Natl. Acad. Sci. U.S.A. 2007
Interaction	Regulatory Rv3133c	active	jhum4u2006	2012-10-05
	Affinity purification (Physical interaction) EH. Sousa, JR. Tuckerman et al. DosT and DevS are oxygen-switched kinases in Mycobacterium tuberculosis. Protein Sci. 2007
Interaction	Regulatory Rv3133c	active	jhum4u2006	2012-10-05
	Affinity purification (Physical interaction) S. Sardiwal,SL. Kendall,F. Movahedzadeh,SC. Rison,NG. Stoker,S. Djordjevic A GAF domain in the hypoxia/NO-inducible Mycobacterium tuberculosis DosS protein binds haem. J. Mol. Biol. 2005
Interaction	Regulatory Rv3133c	active	jhum4u2006	2012-10-05
	Affinity purification (Physical interaction) DK. Saini, V. Malhotra et al. DevR-DevS is a bona fide two-component system of Mycobacterium tuberculosis that is hypoxia-responsive in the absence of the DNA-binding domain of DevR. Microbiology (Reading, Engl.) 2004
Interaction	Regulatory Rv3133c	active	jhum4u2006	2012-10-05
	Affinity purification (Physical interaction) DM. Roberts, RP. Liao et al. Two sensor kinases contribute to the hypoxic response of Mycobacterium tuberculosis. J. Biol. Chem. 2004
Interaction	Regulatory Rv3133c	active	jhum4u2006	2012-10-05
	Affinity purification (Physical interaction) authors,S. Gu,J. Chen,KM. Dobos,EM. Bradbury,JT. Belisle,X. Chen Comprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain. Mol. Cell Proteomics 2003
Interaction	Regulatory Rv3133c	active	jhum4u2006	2012-10-05
	Affinity purification (Physical interaction) MI. Voskuil, D. Schnappinger et al. Inhibition of respiration by nitric oxide induces a Mycobacterium tuberculosis dormancy program. J. Exp. Med. 2003
Interaction	Regulatory Rv3133c	active	jhum4u2006	2012-10-05
	Affinity purification (Physical interaction) HD. Park, KM. Guinn et al. Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. Mol. Microbiol. 2003
Interaction	Regulatory Rv3133c	active	jhum4u2006	2012-10-05
	Affinity purification (Physical interaction) DK. Saini, N. Pant et al. Cloning, overexpression, purification, and matrix-assisted refolding of DevS (Rv 3132c) histidine protein kinase of Mycobacterium tuberculosis. Protein Expr. Purif. 2002
Interaction	Regulatory Rv3133c	active	jhum4u2006	2012-10-05
	Affinity purification (Physical interaction) null. Mayuri, G. Bagchi et al. Molecular analysis of the dormancy response in Mycobacterium smegmatis: expression analysis of genes encoding the DevR-DevS two-component system, Rv3134c and chaperone alpha-crystallin homologues. FEMS Microbiol. Lett. 2002
Interaction	Regulatory Rv3133c	active	jhum4u2006	2012-10-05
	Affinity purification (Physical interaction) authors,JC. Betts,PT. Lukey,LC. Robb,RA. McAdam,K. Duncan Evaluation of a nutrient starvation model of Mycobacterium tuberculosis persistence by gene and protein expression profiling. Mol. Microbiol. 2002
Interaction	Regulatory Rv3133c	active	jhum4u2006	2012-10-05
	Affinity purification (Physical interaction) N. Dasgupta, V. Kapur et al. Characterization of a two-component system, devR-devS, of Mycobacterium tuberculosis. Tuber. Lung Dis. 2000
Interaction	Regulatory Rv3133c	active	jhum4u2006	2012-10-05
	Affinity purification (Physical interaction) DR. Sherman, M. Voskuil et al. Regulation of the Mycobacterium tuberculosis hypoxic response gene encoding alpha -crystallin. Proc. Natl. Acad. Sci. U.S.A. 2001
Interaction	Regulatory Rv3133c	active	jhum4u2006	2012-10-05
	Affinity purification (Physical interaction) PJ. Converse, PC. Karakousis et al. The role of the dosR/dosS two-component regulatory system in Mycobacterium tuberculosis virulence in three animal models. Infect. Immun. 2008
Interaction	Regulatory Rv3133c	active	jhum4u2006	2012-10-05
	Affinity purification (Physical interaction) HY. Cho,HJ. Cho,YM. Kim,JI. Oh,BS. Kang Structural insight into the heme-based redox sensing by DosS from Mycobacterium tuberculosis. J. Biol. Chem. 2009
Interaction	Regulatory Rv3133c	active	hibeeluck	2012-10-05
	Affinity purification (Physical interaction) A. Kumar,JC. Toledo,RP. Patel,JR. Lancaster,AJ. Steyn Mycobacterium tuberculosis DosS is a redox sensor and DosT is a hypoxia sensor. Proc. Natl. Acad. Sci. U.S.A. 2007
Interaction	Regulatory Rv3133c	active	hibeeluck	2012-10-05
	Affinity purification (Physical interaction) EH. Sousa, JR. Tuckerman et al. DosT and DevS are oxygen-switched kinases in Mycobacterium tuberculosis. Protein Sci. 2007
Interaction	Regulatory Rv3133c	active	hibeeluck	2012-10-05
	Affinity purification (Physical interaction) S. Sardiwal,SL. Kendall,F. Movahedzadeh,SC. Rison,NG. Stoker,S. Djordjevic A GAF domain in the hypoxia/NO-inducible Mycobacterium tuberculosis DosS protein binds haem. J. Mol. Biol. 2005
Interaction	Regulatory Rv3133c	active	hibeeluck	2012-10-05
	Affinity purification (Physical interaction) DK. Saini, V. Malhotra et al. DevR-DevS is a bona fide two-component system of Mycobacterium tuberculosis that is hypoxia-responsive in the absence of the DNA-binding domain of DevR. Microbiology (Reading, Engl.) 2004
Interaction	Regulatory Rv3133c	active	hibeeluck	2012-10-05
	Affinity purification (Physical interaction) DM. Roberts, RP. Liao et al. Two sensor kinases contribute to the hypoxic response of Mycobacterium tuberculosis. J. Biol. Chem. 2004
Interaction	Regulatory Rv3133c	active	hibeeluck	2012-10-05
	Affinity purification (Physical interaction) authors,S. Gu,J. Chen,KM. Dobos,EM. Bradbury,JT. Belisle,X. Chen Comprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain. Mol. Cell Proteomics 2003
Interaction	Regulatory Rv3133c	active	hibeeluck	2012-10-05
	Affinity purification (Physical interaction) MI. Voskuil, D. Schnappinger et al. Inhibition of respiration by nitric oxide induces a Mycobacterium tuberculosis dormancy program. J. Exp. Med. 2003
Interaction	Regulatory Rv3133c	active	hibeeluck	2012-10-05
	Affinity purification (Physical interaction) HD. Park, KM. Guinn et al. Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. Mol. Microbiol. 2003
Interaction	Regulatory Rv3133c	active	hibeeluck	2012-10-05
	Affinity purification (Physical interaction) DK. Saini, N. Pant et al. Cloning, overexpression, purification, and matrix-assisted refolding of DevS (Rv 3132c) histidine protein kinase of Mycobacterium tuberculosis. Protein Expr. Purif. 2002
Interaction	Regulatory Rv3133c	active	hibeeluck	2012-10-05
	Affinity purification (Physical interaction) null. Mayuri, G. Bagchi et al. Molecular analysis of the dormancy response in Mycobacterium smegmatis: expression analysis of genes encoding the DevR-DevS two-component system, Rv3134c and chaperone alpha-crystallin homologues. FEMS Microbiol. Lett. 2002
Interaction	Regulatory Rv3133c	active	hibeeluck	2012-10-05
	Affinity purification (Physical interaction) authors,JC. Betts,PT. Lukey,LC. Robb,RA. McAdam,K. Duncan Evaluation of a nutrient starvation model of Mycobacterium tuberculosis persistence by gene and protein expression profiling. Mol. Microbiol. 2002
Interaction	Regulatory Rv3133c	active	hibeeluck	2012-10-05
	Affinity purification (Physical interaction) N. Dasgupta, V. Kapur et al. Characterization of a two-component system, devR-devS, of Mycobacterium tuberculosis. Tuber. Lung Dis. 2000
Interaction	Regulatory Rv3133c	active	hibeeluck	2012-10-05
	Affinity purification (Physical interaction) DR. Sherman, M. Voskuil et al. Regulation of the Mycobacterium tuberculosis hypoxic response gene encoding alpha -crystallin. Proc. Natl. Acad. Sci. U.S.A. 2001
Interaction	Regulatory Rv3133c	active	hibeeluck	2012-10-05
	Affinity purification (Physical interaction) PJ. Converse, PC. Karakousis et al. The role of the dosR/dosS two-component regulatory system in Mycobacterium tuberculosis virulence in three animal models. Infect. Immun. 2008
Interaction	Regulatory Rv3133c	active	hibeeluck	2012-10-05
	Affinity purification (Physical interaction) HY. Cho,HJ. Cho,YM. Kim,JI. Oh,BS. Kang Structural insight into the heme-based redox sensing by DosS from Mycobacterium tuberculosis. J. Biol. Chem. 2009
Interaction	Activates Rv2028c	active	priti.priety	2012-10-05
	Coexpression(Functional linkage) authors,IG. Alekseeva,GP. Lapina,ZD. Tulovskaia,VN. Izma-lova [Structure formation in interphase adsorption layers of lysozyme at liquid boundaries]. Biofizika null
Interaction	Activates Rv2028c	active	priti.priety	2012-10-05
	Coexpression(Functional linkage) authors,BM. Altura Role of prostaglandins and histamine in reactive hyperemia: in-vivo studies on single mesenteric arterioles. Prostaglandins Med 1978
Interaction	Activates Rv2028c	active	priti.priety	2012-10-05
	Coexpression(Functional linkage) J. Starck, G. Källenius et al. Comparative proteome analysis of Mycobacterium tuberculosis grown under aerobic and anaerobic conditions. Microbiology (Reading, Engl.) 2004
Interaction	ActivatedBy Rv2027c	active	priti.priety	2012-10-05
	Band Shift DM. Roberts, RP. Liao et al. Two sensor kinases contribute to the hypoxic response of Mycobacterium tuberculosis. J. Biol. Chem. 2004
Interaction	ActivatedBy Rv2027c	active	priti.priety	2012-10-05
	Band Shift DK. Saini, V. Malhotra et al. Cross talk between DevS sensor kinase homologue, Rv2027c, and DevR response regulator of Mycobacterium tuberculosis. FEBS Lett. 2004
Interaction	Activates Rv2026c	active	priti.priety	2012-10-05
	Coexpression(Functional linkage) authors,IG. Alekseeva,GP. Lapina,ZD. Tulovskaia,VN. Izma-lova [Structure formation in interphase adsorption layers of lysozyme at liquid boundaries]. Biofizika null
Interaction	Activates Rv2026c	active	priti.priety	2012-10-05
	Coexpression(Functional linkage) authors,BM. Altura Role of prostaglandins and histamine in reactive hyperemia: in-vivo studies on single mesenteric arterioles. Prostaglandins Med 1978
Interaction	Activates Rv2026c	active	priti.priety	2012-10-05
	Coexpression(Functional linkage) J. Starck, G. Källenius et al. Comparative proteome analysis of Mycobacterium tuberculosis grown under aerobic and anaerobic conditions. Microbiology (Reading, Engl.) 2004
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) ML. Chesne-Seck, N. Barilone et al. A point mutation in the two-component regulator PhoP-PhoR accounts for the absence of polyketide-derived acyltrehaloses but not that of phthiocerol dimycocerosates in Mycobacterium tuberculosis H37Ra. J. Bacteriol. 2008
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) authors,A. Sola-Landa,RS. Moura,JF. Martín The two-component PhoR-PhoP system controls both primary metabolism and secondary metabolite biosynthesis in Streptomyces lividans. Proc. Natl. Acad. Sci. U.S.A. 2003
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) J. Gonzalo Asensio, C. Maia et al. The virulence-associated two-component PhoP-PhoR system controls the biosynthesis of polyketide-derived lipids in Mycobacterium tuberculosis. J. Biol. Chem. 2006
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) J. Gonzalo-Asensio, CY. Soto et al. The Mycobacterium tuberculosis phoPR operon is positively autoregulated in the virulent strain H37Rv. J. Bacteriol. 2008
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) A. Sinha, S. Gupta et al. PhoP-PhoP interaction at adjacent PhoP binding sites is influenced by protein phosphorylation. J. Bacteriol. 2008
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) J. Gonzalo Asensio, C. Maia et al. The virulence-associated two-component PhoP-PhoR system controls the biosynthesis of polyketide-derived lipids in Mycobacterium tuberculosis. J. Biol. Chem. 2006
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) M. Ryndak, S. Wang et al. PhoP, a key player in Mycobacterium tuberculosis virulence. Trends Microbiol. 2008
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) JA. Asensio, A. Arbués et al. Live tuberculosis vaccines based on phoP mutants: a step towards clinical trials. Expert opinion on biological therapy 2008
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) SB. Walters, E. Dubnau et al. The Mycobacterium tuberculosis PhoPR two-component system regulates genes essential for virulence and complex lipid biosynthesis. Mol. Microbiol. 2006
Interaction	Regulatory Rv0757	active	singhpankaj2116	2012-10-05
	Co-expression (Functional linkage) J. Gonzalo-Asensio, S. Mostowy et al. PhoP: a missing piece in the intricate puzzle of Mycobacterium tuberculosis virulence. PLoS ONE 2008
Interaction	Regulatory Rv0375c	active	prabhakarsmail	2012-10-05
	Co-expression (Functional linkage) A. Kumar,JS. Deshane,DK. Crossman,S. Bolisetty,BS. Yan,I. Kramnik,A. Agarwal,AJ. Steyn Heme oxygenase-1-derived carbon monoxide induces the Mycobacterium tuberculosis dormancy regulon. J. Biol. Chem. 2008
Interaction	Regulatory Rv0375c	active	akankshajain.21	2012-10-05
	Co-expression (Functional linkage) A. Kumar,JS. Deshane,DK. Crossman,S. Bolisetty,BS. Yan,I. Kramnik,A. Agarwal,AJ. Steyn Heme oxygenase-1-derived carbon monoxide induces the Mycobacterium tuberculosis dormancy regulon. J. Biol. Chem. 2008
Interaction	Regulatory Rv0374c	active	prabhakarsmail	2012-10-05
	Co-expression (Functional linkage) A. Kumar,JS. Deshane,DK. Crossman,S. Bolisetty,BS. Yan,I. Kramnik,A. Agarwal,AJ. Steyn Heme oxygenase-1-derived carbon monoxide induces the Mycobacterium tuberculosis dormancy regulon. J. Biol. Chem. 2008
Interaction	Regulatory Rv0374c	active	akankshajain.21	2012-10-05
	Co-expression (Functional linkage) A. Kumar,JS. Deshane,DK. Crossman,S. Bolisetty,BS. Yan,I. Kramnik,A. Agarwal,AJ. Steyn Heme oxygenase-1-derived carbon monoxide induces the Mycobacterium tuberculosis dormancy regulon. J. Biol. Chem. 2008
Interaction	Regulatory Rv0373c	active	prabhakarsmail	2012-10-05
	Co-expression (Functional linkage) A. Kumar,JS. Deshane,DK. Crossman,S. Bolisetty,BS. Yan,I. Kramnik,A. Agarwal,AJ. Steyn Heme oxygenase-1-derived carbon monoxide induces the Mycobacterium tuberculosis dormancy regulon. J. Biol. Chem. 2008
Interaction	Regulatory Rv0373c	active	akankshajain.21	2012-10-05
	Co-expression (Functional linkage) A. Kumar,JS. Deshane,DK. Crossman,S. Bolisetty,BS. Yan,I. Kramnik,A. Agarwal,AJ. Steyn Heme oxygenase-1-derived carbon monoxide induces the Mycobacterium tuberculosis dormancy regulon. J. Biol. Chem. 2008
Interaction	RegulatedBy Rv0485	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. RM. Goldstone, SD. Goonesekera et al. The transcriptional regulator Rv0485 modulates the expression of a pe and ppe gene pair and is required for Mycobacterium tuberculosis virulence. Infect. Immun. 2009
Interaction	RegulatedBy Rv0485	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. RM. Goldstone, SD. Goonesekera et al. The transcriptional regulator Rv0485 modulates the expression of a pe and ppe gene pair and is required for Mycobacterium tuberculosis virulence. Infect. Immun. 2009
Interaction	RegulatedBy Rv3833	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv3692	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv3133c	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv2669	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv2017	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv0491	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv0757	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. J. Gonzalo Asensio, C. Maia et al. The virulence-associated two-component PhoP-PhoR system controls the biosynthesis of polyketide-derived lipids in Mycobacterium tuberculosis. J. Biol. Chem. 2006
Interaction	RegulatedBy Rv3133c	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. HD. Park, KM. Guinn et al. Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. Mol. Microbiol. 2003
Interaction	Regulatory Rv3133c	active	jhum4u2006	2012-10-03
	Co-occurrence (Functional linkage) A. Kumar,JC. Toledo,RP. Patel,JR. Lancaster,AJ. Steyn Mycobacterium tuberculosis DosS is a redox sensor and DosT is a hypoxia sensor. Proc. Natl. Acad. Sci. U.S.A. 2007
Interaction	Regulatory Rv3133c	active	jhum4u2006	2012-10-03
	Co-occurrence (Functional linkage) EH. Sousa, JR. Tuckerman et al. DosT and DevS are oxygen-switched kinases in Mycobacterium tuberculosis. Protein Sci. 2007
Interaction	Regulatory Rv3133c	active	jhum4u2006	2012-10-03
	Co-occurrence (Functional linkage) S. Sardiwal,SL. Kendall,F. Movahedzadeh,SC. Rison,NG. Stoker,S. Djordjevic A GAF domain in the hypoxia/NO-inducible Mycobacterium tuberculosis DosS protein binds haem. J. Mol. Biol. 2005
Interaction	Regulatory Rv3133c	active	jhum4u2006	2012-10-03
	Co-occurrence (Functional linkage) DK. Saini, V. Malhotra et al. DevR-DevS is a bona fide two-component system of Mycobacterium tuberculosis that is hypoxia-responsive in the absence of the DNA-binding domain of DevR. Microbiology (Reading, Engl.) 2004
Interaction	Regulatory Rv3133c	active	jhum4u2006	2012-10-03
	Co-occurrence (Functional linkage) DM. Roberts, RP. Liao et al. Two sensor kinases contribute to the hypoxic response of Mycobacterium tuberculosis. J. Biol. Chem. 2004
Interaction	Regulatory Rv3133c	active	jhum4u2006	2012-10-03
	Co-occurrence (Functional linkage) authors,S. Gu,J. Chen,KM. Dobos,EM. Bradbury,JT. Belisle,X. Chen Comprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain. Mol. Cell Proteomics 2003
Interaction	Regulatory Rv3133c	active	jhum4u2006	2012-10-03
	Co-occurrence (Functional linkage) MI. Voskuil, D. Schnappinger et al. Inhibition of respiration by nitric oxide induces a Mycobacterium tuberculosis dormancy program. J. Exp. Med. 2003
Interaction	Regulatory Rv3133c	active	jhum4u2006	2012-10-03
	Co-occurrence (Functional linkage) HD. Park, KM. Guinn et al. Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. Mol. Microbiol. 2003
Interaction	Regulatory Rv3133c	active	jhum4u2006	2012-10-03
	Co-occurrence (Functional linkage) DK. Saini, N. Pant et al. Cloning, overexpression, purification, and matrix-assisted refolding of DevS (Rv 3132c) histidine protein kinase of Mycobacterium tuberculosis. Protein Expr. Purif. 2002
Interaction	Regulatory Rv3133c	active	jhum4u2006	2012-10-03
	Co-occurrence (Functional linkage) null. Mayuri, G. Bagchi et al. Molecular analysis of the dormancy response in Mycobacterium smegmatis: expression analysis of genes encoding the DevR-DevS two-component system, Rv3134c and chaperone alpha-crystallin homologues. FEMS Microbiol. Lett. 2002
Interaction	Regulatory Rv3133c	active	jhum4u2006	2012-10-03
	Co-occurrence (Functional linkage) authors,JC. Betts,PT. Lukey,LC. Robb,RA. McAdam,K. Duncan Evaluation of a nutrient starvation model of Mycobacterium tuberculosis persistence by gene and protein expression profiling. Mol. Microbiol. 2002
Interaction	Regulatory Rv3133c	active	jhum4u2006	2012-10-03
	Co-occurrence (Functional linkage) N. Dasgupta, V. Kapur et al. Characterization of a two-component system, devR-devS, of Mycobacterium tuberculosis. Tuber. Lung Dis. 2000
Interaction	Regulatory Rv3133c	active	jhum4u2006	2012-10-03
	Co-occurrence (Functional linkage) DR. Sherman, M. Voskuil et al. Regulation of the Mycobacterium tuberculosis hypoxic response gene encoding alpha -crystallin. Proc. Natl. Acad. Sci. U.S.A. 2001
Interaction	Regulatory Rv3133c	active	jhum4u2006	2012-10-03
	Co-occurrence (Functional linkage) PJ. Converse, PC. Karakousis et al. The role of the dosR/dosS two-component regulatory system in Mycobacterium tuberculosis virulence in three animal models. Infect. Immun. 2008
Interaction	Regulatory Rv3133c	active	jhum4u2006	2012-10-03
	Co-occurrence (Functional linkage) HY. Cho,HJ. Cho,YM. Kim,JI. Oh,BS. Kang Structural insight into the heme-based redox sensing by DosS from Mycobacterium tuberculosis. J. Biol. Chem. 2009
Interaction	Regulatory Rv3133c	active	jhum4u2006	2012-10-03
	Affinity purification (Physical interaction) A. Kumar,JC. Toledo,RP. Patel,JR. Lancaster,AJ. Steyn Mycobacterium tuberculosis DosS is a redox sensor and DosT is a hypoxia sensor. Proc. Natl. Acad. Sci. U.S.A. 2007
Interaction	Regulatory Rv3133c	active	jhum4u2006	2012-10-03
	Affinity purification (Physical interaction) EH. Sousa, JR. Tuckerman et al. DosT and DevS are oxygen-switched kinases in Mycobacterium tuberculosis. Protein Sci. 2007
Interaction	Regulatory Rv3133c	active	jhum4u2006	2012-10-03
	Affinity purification (Physical interaction) S. Sardiwal,SL. Kendall,F. Movahedzadeh,SC. Rison,NG. Stoker,S. Djordjevic A GAF domain in the hypoxia/NO-inducible Mycobacterium tuberculosis DosS protein binds haem. J. Mol. Biol. 2005
Interaction	Regulatory Rv3133c	active	jhum4u2006	2012-10-03
	Affinity purification (Physical interaction) DK. Saini, V. Malhotra et al. DevR-DevS is a bona fide two-component system of Mycobacterium tuberculosis that is hypoxia-responsive in the absence of the DNA-binding domain of DevR. Microbiology (Reading, Engl.) 2004
Interaction	Regulatory Rv3133c	active	jhum4u2006	2012-10-03
	Affinity purification (Physical interaction) DM. Roberts, RP. Liao et al. Two sensor kinases contribute to the hypoxic response of Mycobacterium tuberculosis. J. Biol. Chem. 2004
Interaction	Regulatory Rv3133c	active	jhum4u2006	2012-10-03
	Affinity purification (Physical interaction) authors,S. Gu,J. Chen,KM. Dobos,EM. Bradbury,JT. Belisle,X. Chen Comprehensive proteomic profiling of the membrane constituents of a Mycobacterium tuberculosis strain. Mol. Cell Proteomics 2003
Interaction	Regulatory Rv3133c	active	jhum4u2006	2012-10-03
	Affinity purification (Physical interaction) MI. Voskuil, D. Schnappinger et al. Inhibition of respiration by nitric oxide induces a Mycobacterium tuberculosis dormancy program. J. Exp. Med. 2003
Interaction	Regulatory Rv3133c	active	jhum4u2006	2012-10-03
	Affinity purification (Physical interaction) HD. Park, KM. Guinn et al. Rv3133c/dosR is a transcription factor that mediates the hypoxic response of Mycobacterium tuberculosis. Mol. Microbiol. 2003
Interaction	Regulatory Rv3133c	active	jhum4u2006	2012-10-03
	Affinity purification (Physical interaction) DK. Saini, N. Pant et al. Cloning, overexpression, purification, and matrix-assisted refolding of DevS (Rv 3132c) histidine protein kinase of Mycobacterium tuberculosis. Protein Expr. Purif. 2002
Interaction	Regulatory Rv3133c	active	jhum4u2006	2012-10-03
	Affinity purification (Physical interaction) null. Mayuri, G. Bagchi et al. Molecular analysis of the dormancy response in Mycobacterium smegmatis: expression analysis of genes encoding the DevR-DevS two-component system, Rv3134c and chaperone alpha-crystallin homologues. FEMS Microbiol. Lett. 2002
Interaction	Regulatory Rv3133c	active	jhum4u2006	2012-10-03
	Affinity purification (Physical interaction) authors,JC. Betts,PT. Lukey,LC. Robb,RA. McAdam,K. Duncan Evaluation of a nutrient starvation model of Mycobacterium tuberculosis persistence by gene and protein expression profiling. Mol. Microbiol. 2002
Interaction	Regulatory Rv3133c	active	jhum4u2006	2012-10-03
	Affinity purification (Physical interaction) N. Dasgupta, V. Kapur et al. Characterization of a two-component system, devR-devS, of Mycobacterium tuberculosis. Tuber. Lung Dis. 2000
Interaction	Regulatory Rv3133c	active	jhum4u2006	2012-10-03
	Affinity purification (Physical interaction) DR. Sherman, M. Voskuil et al. Regulation of the Mycobacterium tuberculosis hypoxic response gene encoding alpha -crystallin. Proc. Natl. Acad. Sci. U.S.A. 2001
Interaction	Regulatory Rv3133c	active	jhum4u2006	2012-10-03
	Affinity purification (Physical interaction) PJ. Converse, PC. Karakousis et al. The role of the dosR/dosS two-component regulatory system in Mycobacterium tuberculosis virulence in three animal models. Infect. Immun. 2008
Interaction	Regulatory Rv3133c	active	jhum4u2006	2012-10-03
	Affinity purification (Physical interaction) HY. Cho,HJ. Cho,YM. Kim,JI. Oh,BS. Kang Structural insight into the heme-based redox sensing by DosS from Mycobacterium tuberculosis. J. Biol. Chem. 2009