Rv3152 - NADH dehydrogenase I chain H nuoH

Expression: Most Significant Conditions for Rv3152

Protein Domains

Gene Information
Locus	Rv3152
Symbol	nuoH
Gene Name	NADH dehydrogenase I chain H nuoH
Location	3519282 - 3520514 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:1233 bp Protein:411 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	29342
Related Genes	Acel_0274 MAP3208 MAV_4040 Mkms_1597 Mmcs_1573 MSMEG_2056 MT3240 MUL_2466 Mvan_1878 nfa26600 PPA1929 SAV4844
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv3152
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv3152 Transcript 1
MTTFGHDTWWLVAAKAIAVFVFLMLTVLVAILAERKLLGRMQLRPGPNRVGPKGALQSLA
DGIKLALKESITPGGIDRFVYFVAPIISVIPAFTAFAFIPFGPEVSVFGHRTPLQITDLP
VAVLFILGLSAIGVYGIVLGGWASGSTYPLLGGVRSTAQVISYEVAMGLSFATVFLMAGT
MSTSQIVAAQDGVWYAFLLLPSFVIYLISMVGETNRAPFDLPEAEGELVAGFHTEYSSLK
FAMFMLAEYVNMTTVSALAATLFFGGWHAPWPLNMWASANTGWWPLIWFTAKVWGFLFIY
FWLRATLPRLRYDQFMALGWKLLIPVSLVWVMVAAIIRSLRNQGYQYWTPTLVFSSIVVA
AAMVLLLRKPLSAPGARASARQRGDEGTSPEPAFPTPPLLAGATKENAGG*

Genomic Sequence

>Rv3152
ATGACCACGTTCGGCCACGACACCTGGTGGCTGGTGGCGGCCAAAGCGATCGCGGTATTC
GTGTTCCTCATGCTGACGGTGCTGGTGGCGATCCTGGCCGAACGCAAGCTGCTGGGCCGG
ATGCAGTTGCGGCCCGGCCCCAACCGGGTTGGCCCAAAAGGAGCCCTGCAGAGCCTGGCT
GACGGCATCAAGCTGGCGCTCAAAGAGAGCATCACACCCGGTGGCATCGATCGATTCGTA
TATTTTGTGGCGCCGATCATTTCGGTGATTCCGGCATTCACCGCTTTCGCGTTCATCCCG
TTTGGTCCCGAGGTGTCGGTGTTTGGCCACCGGACACCGTTGCAGATAACCGACCTTCCC
GTCGCCGTGCTGTTCATCCTGGGACTGTCGGCGATCGGGGTATACGGCATCGTGCTGGGC
GGTTGGGCGTCCGGGTCCACCTACCCGCTGCTGGGCGGGGTGCGCTCCACCGCGCAGGTC
ATCTCCTACGAGGTCGCGATGGGCCTGTCGTTCGCGACGGTGTTCCTTATGGCCGGCACC
ATGTCGACGTCGCAGATCGTGGCCGCACAAGACGGTGTCTGGTATGCCTTCCTGTTGTTG
CCGTCATTCGTCATCTATCTCATTTCTATGGTGGGTGAAACCAACCGGGCGCCGTTCGAT
TTGCCCGAAGCCGAGGGCGAGCTGGTCGCGGGATTCCACACCGAGTACTCGTCGTTGAAG
TTCGCGATGTTCATGCTCGCCGAGTACGTCAATATGACTACGGTTTCGGCACTGGCCGCG
ACCCTATTCTTCGGTGGCTGGCATGCTCCCTGGCCGCTGAACATGTGGGCGAGCGCCAAC
ACCGGCTGGTGGCCACTGATCTGGTTCACCGCTAAAGTGTGGGGCTTTCTGTTCATCTAT
TTCTGGCTGCGGGCTACGCTGCCGCGGCTGCGCTACGACCAGTTCATGGCGCTGGGCTGG
AAGTTATTGATCCCCGTCTCGCTGGTGTGGGTGATGGTCGCCGCGATCATCCGCTCACTA
CGCAACCAGGGCTACCAGTACTGGACCCCGACTCTGGTGTTTAGCAGCATTGTCGTTGCC
GCTGCCATGGTGCTGTTGTTGCGAAAGCCGTTGAGCGCTCCCGGCGCTCGCGCATCGGCA
CGGCAACGCGGGGACGAAGGCACCAGCCCTGAACCGGCATTTCCGACACCACCGCTGCTA
GCCGGTGCAACCAAGGAGAATGCAGGTGGCTAA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	PhysicalInteraction Rv3158	active	jhum4u2006	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3158	active	jhum4u2006	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3158	active	jhum4u2006	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3158	active	jhum4u2006	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3158	active	jhum4u2006	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3158	active	hibeeluck	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3158	active	hibeeluck	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3158	active	hibeeluck	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3158	active	hibeeluck	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3158	active	hibeeluck	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3157	active	jhum4u2006	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3157	active	jhum4u2006	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3157	active	jhum4u2006	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3157	active	jhum4u2006	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3157	active	jhum4u2006	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3157	active	hibeeluck	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3157	active	hibeeluck	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3157	active	hibeeluck	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3157	active	hibeeluck	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3157	active	hibeeluck	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3156	active	jhum4u2006	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3156	active	jhum4u2006	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3156	active	jhum4u2006	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3156	active	jhum4u2006	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3156	active	jhum4u2006	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3156	active	hibeeluck	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3156	active	hibeeluck	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3156	active	hibeeluck	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3156	active	hibeeluck	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3156	active	hibeeluck	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3155	active	jhum4u2006	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3155	active	jhum4u2006	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3155	active	jhum4u2006	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3155	active	jhum4u2006	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3155	active	jhum4u2006	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3155	active	hibeeluck	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3155	active	hibeeluck	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3155	active	hibeeluck	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3155	active	hibeeluck	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3155	active	hibeeluck	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3154	active	jhum4u2006	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3154	active	jhum4u2006	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3154	active	jhum4u2006	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3154	active	jhum4u2006	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3154	active	jhum4u2006	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3154	active	hibeeluck	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3154	active	hibeeluck	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3154	active	hibeeluck	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3154	active	hibeeluck	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3154	active	hibeeluck	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3153	active	jhum4u2006	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3153	active	jhum4u2006	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3153	active	jhum4u2006	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3153	active	jhum4u2006	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3153	active	jhum4u2006	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3153	active	hibeeluck	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3153	active	hibeeluck	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3153	active	hibeeluck	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3153	active	hibeeluck	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3153	active	hibeeluck	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3158	active	jhum4u2006	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3157	active	jhum4u2006	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3156	active	jhum4u2006	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3155	active	jhum4u2006	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3154	active	jhum4u2006	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3153	active	jhum4u2006	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3152	active	jhum4u2006	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3152	active	jhum4u2006	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3150	active	jhum4u2006	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3149	active	jhum4u2006	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3148	active	jhum4u2006	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3147	active	jhum4u2006	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3146	active	jhum4u2006	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3145	active	jhum4u2006	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3158	active	jhum4u2006	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3157	active	jhum4u2006	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3156	active	jhum4u2006	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3155	active	jhum4u2006	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3154	active	jhum4u2006	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3153	active	jhum4u2006	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3152	active	jhum4u2006	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3152	active	jhum4u2006	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3150	active	jhum4u2006	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3149	active	jhum4u2006	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3148	active	jhum4u2006	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3147	active	jhum4u2006	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3146	active	jhum4u2006	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3145	active	jhum4u2006	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3158	active	jhum4u2006	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3157	active	jhum4u2006	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3156	active	jhum4u2006	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3155	active	jhum4u2006	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3154	active	jhum4u2006	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3153	active	jhum4u2006	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3152	active	jhum4u2006	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3152	active	jhum4u2006	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3150	active	jhum4u2006	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3149	active	jhum4u2006	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3148	active	jhum4u2006	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3147	active	jhum4u2006	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3146	active	jhum4u2006	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3145	active	jhum4u2006	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3158	active	jhum4u2006	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3157	active	jhum4u2006	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3156	active	jhum4u2006	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3155	active	jhum4u2006	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3154	active	jhum4u2006	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3153	active	jhum4u2006	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3152	active	jhum4u2006	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3152	active	jhum4u2006	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3150	active	jhum4u2006	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3149	active	jhum4u2006	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3148	active	jhum4u2006	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3147	active	jhum4u2006	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3146	active	jhum4u2006	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3145	active	jhum4u2006	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3158	active	jhum4u2006	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3157	active	jhum4u2006	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3156	active	jhum4u2006	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3155	active	jhum4u2006	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3154	active	jhum4u2006	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3153	active	jhum4u2006	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3152	active	jhum4u2006	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3152	active	jhum4u2006	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3150	active	jhum4u2006	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3149	active	jhum4u2006	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3148	active	jhum4u2006	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3147	active	jhum4u2006	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3146	active	jhum4u2006	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3145	active	jhum4u2006	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3158	active	hibeeluck	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3157	active	hibeeluck	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3156	active	hibeeluck	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3155	active	hibeeluck	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3154	active	hibeeluck	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3153	active	hibeeluck	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3152	active	hibeeluck	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3152	active	hibeeluck	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3150	active	hibeeluck	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3149	active	hibeeluck	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3148	active	hibeeluck	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3147	active	hibeeluck	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3146	active	hibeeluck	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3145	active	hibeeluck	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3158	active	hibeeluck	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3157	active	hibeeluck	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3156	active	hibeeluck	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3155	active	hibeeluck	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3154	active	hibeeluck	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3153	active	hibeeluck	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3152	active	hibeeluck	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3152	active	hibeeluck	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3150	active	hibeeluck	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3149	active	hibeeluck	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3148	active	hibeeluck	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3147	active	hibeeluck	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3146	active	hibeeluck	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3145	active	hibeeluck	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3158	active	hibeeluck	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3157	active	hibeeluck	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3156	active	hibeeluck	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3155	active	hibeeluck	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3154	active	hibeeluck	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3153	active	hibeeluck	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3152	active	hibeeluck	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3152	active	hibeeluck	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3150	active	hibeeluck	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3149	active	hibeeluck	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3148	active	hibeeluck	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3147	active	hibeeluck	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3146	active	hibeeluck	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3145	active	hibeeluck	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3158	active	hibeeluck	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3157	active	hibeeluck	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3156	active	hibeeluck	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3155	active	hibeeluck	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3154	active	hibeeluck	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3153	active	hibeeluck	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3152	active	hibeeluck	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3152	active	hibeeluck	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3150	active	hibeeluck	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3149	active	hibeeluck	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3148	active	hibeeluck	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3147	active	hibeeluck	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3146	active	hibeeluck	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3145	active	hibeeluck	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3158	active	hibeeluck	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3157	active	hibeeluck	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3156	active	hibeeluck	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3155	active	hibeeluck	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3154	active	hibeeluck	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3153	active	hibeeluck	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3152	active	hibeeluck	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3152	active	hibeeluck	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3150	active	hibeeluck	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3149	active	hibeeluck	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3148	active	hibeeluck	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3147	active	hibeeluck	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3146	active	hibeeluck	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3145	active	hibeeluck	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3151	active	jhum4u2006	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3151	active	jhum4u2006	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3151	active	jhum4u2006	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3151	active	jhum4u2006	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3151	active	jhum4u2006	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3151	active	hibeeluck	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3151	active	hibeeluck	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3151	active	hibeeluck	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3151	active	hibeeluck	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3151	active	hibeeluck	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3150	active	jhum4u2006	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3150	active	jhum4u2006	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3150	active	jhum4u2006	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3150	active	jhum4u2006	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3150	active	jhum4u2006	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3150	active	hibeeluck	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3150	active	hibeeluck	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3150	active	hibeeluck	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3150	active	hibeeluck	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3150	active	hibeeluck	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3149	active	jhum4u2006	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3149	active	jhum4u2006	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3149	active	jhum4u2006	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3149	active	jhum4u2006	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3149	active	jhum4u2006	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3149	active	hibeeluck	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3149	active	hibeeluck	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3149	active	hibeeluck	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3149	active	hibeeluck	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3149	active	hibeeluck	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3148	active	jhum4u2006	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3148	active	jhum4u2006	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3148	active	jhum4u2006	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3148	active	jhum4u2006	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3148	active	jhum4u2006	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3148	active	hibeeluck	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3148	active	hibeeluck	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3148	active	hibeeluck	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3148	active	hibeeluck	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3148	active	hibeeluck	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3147	active	jhum4u2006	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3147	active	jhum4u2006	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3147	active	jhum4u2006	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3147	active	jhum4u2006	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3147	active	jhum4u2006	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3147	active	hibeeluck	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3147	active	hibeeluck	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3147	active	hibeeluck	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3147	active	hibeeluck	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3147	active	hibeeluck	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3146	active	jhum4u2006	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3146	active	jhum4u2006	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3146	active	jhum4u2006	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3146	active	jhum4u2006	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3146	active	jhum4u2006	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3146	active	hibeeluck	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3146	active	hibeeluck	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3146	active	hibeeluck	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3146	active	hibeeluck	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3146	active	hibeeluck	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3145	active	jhum4u2006	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3145	active	jhum4u2006	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3145	active	jhum4u2006	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3145	active	jhum4u2006	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3145	active	jhum4u2006	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3145	active	hibeeluck	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3145	active	hibeeluck	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3145	active	hibeeluck	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3145	active	hibeeluck	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3145	active	hibeeluck	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	RegulatedBy Rv0348	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. B. Abomoelak, EA. Hoye et al. mosR, a novel transcriptional regulator of hypoxia and virulence in Mycobacterium tuberculosis. J. Bacteriol. 2009
Interaction	RegulatedBy Rv0981	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. H. He, R. Hovey et al. MprAB is a stress-responsive two-component system that directly regulates expression of sigma factors SigB and SigE in Mycobacterium tuberculosis. J. Bacteriol. 2006
Interaction	PhysicalInteraction Rv3158	active	jhum4u2006	2012-10-03
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3158	active	jhum4u2006	2012-10-03
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3158	active	jhum4u2006	2012-10-03
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3158	active	jhum4u2006	2012-10-03
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3158	active	jhum4u2006	2012-10-03
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3157	active	jhum4u2006	2012-10-03
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3157	active	jhum4u2006	2012-10-03
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3157	active	jhum4u2006	2012-10-03
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3157	active	jhum4u2006	2012-10-03
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3157	active	jhum4u2006	2012-10-03
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3156	active	jhum4u2006	2012-10-03
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3156	active	jhum4u2006	2012-10-03
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3156	active	jhum4u2006	2012-10-03
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3156	active	jhum4u2006	2012-10-03
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3156	active	jhum4u2006	2012-10-03
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3155	active	jhum4u2006	2012-10-03
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3155	active	jhum4u2006	2012-10-03
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3155	active	jhum4u2006	2012-10-03
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3155	active	jhum4u2006	2012-10-03
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3155	active	jhum4u2006	2012-10-03
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3154	active	jhum4u2006	2012-10-03
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3154	active	jhum4u2006	2012-10-03
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3154	active	jhum4u2006	2012-10-03
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3154	active	jhum4u2006	2012-10-03
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3154	active	jhum4u2006	2012-10-03
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3153	active	jhum4u2006	2012-10-03
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3153	active	jhum4u2006	2012-10-03
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3153	active	jhum4u2006	2012-10-03
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3153	active	jhum4u2006	2012-10-03
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3153	active	jhum4u2006	2012-10-03
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3158	active	jhum4u2006	2012-10-03
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3157	active	jhum4u2006	2012-10-03
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3156	active	jhum4u2006	2012-10-03
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3155	active	jhum4u2006	2012-10-03
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3154	active	jhum4u2006	2012-10-03
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3153	active	jhum4u2006	2012-10-03
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3152	active	jhum4u2006	2012-10-03
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3152	active	jhum4u2006	2012-10-03
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3150	active	jhum4u2006	2012-10-03
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3149	active	jhum4u2006	2012-10-03
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3148	active	jhum4u2006	2012-10-03
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3147	active	jhum4u2006	2012-10-03
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3146	active	jhum4u2006	2012-10-03
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3145	active	jhum4u2006	2012-10-03
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3158	active	jhum4u2006	2012-10-03
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3157	active	jhum4u2006	2012-10-03
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3156	active	jhum4u2006	2012-10-03
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3155	active	jhum4u2006	2012-10-03
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3154	active	jhum4u2006	2012-10-03
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3153	active	jhum4u2006	2012-10-03
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3152	active	jhum4u2006	2012-10-03
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3152	active	jhum4u2006	2012-10-03
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3150	active	jhum4u2006	2012-10-03
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3149	active	jhum4u2006	2012-10-03
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3148	active	jhum4u2006	2012-10-03
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3147	active	jhum4u2006	2012-10-03
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3146	active	jhum4u2006	2012-10-03
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3145	active	jhum4u2006	2012-10-03
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3158	active	jhum4u2006	2012-10-03
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3157	active	jhum4u2006	2012-10-03
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3156	active	jhum4u2006	2012-10-03
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3155	active	jhum4u2006	2012-10-03
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3154	active	jhum4u2006	2012-10-03
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3153	active	jhum4u2006	2012-10-03
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3152	active	jhum4u2006	2012-10-03
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3152	active	jhum4u2006	2012-10-03
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3150	active	jhum4u2006	2012-10-03
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3149	active	jhum4u2006	2012-10-03
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3148	active	jhum4u2006	2012-10-03
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3147	active	jhum4u2006	2012-10-03
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3146	active	jhum4u2006	2012-10-03
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3145	active	jhum4u2006	2012-10-03
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3158	active	jhum4u2006	2012-10-03
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3157	active	jhum4u2006	2012-10-03
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3156	active	jhum4u2006	2012-10-03
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3155	active	jhum4u2006	2012-10-03
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3154	active	jhum4u2006	2012-10-03
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3153	active	jhum4u2006	2012-10-03
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3152	active	jhum4u2006	2012-10-03
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3152	active	jhum4u2006	2012-10-03
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3150	active	jhum4u2006	2012-10-03
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3149	active	jhum4u2006	2012-10-03
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3148	active	jhum4u2006	2012-10-03
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3147	active	jhum4u2006	2012-10-03
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3146	active	jhum4u2006	2012-10-03
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3145	active	jhum4u2006	2012-10-03
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3158	active	jhum4u2006	2012-10-03
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3157	active	jhum4u2006	2012-10-03
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3156	active	jhum4u2006	2012-10-03
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3155	active	jhum4u2006	2012-10-03
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3154	active	jhum4u2006	2012-10-03
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3153	active	jhum4u2006	2012-10-03
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3152	active	jhum4u2006	2012-10-03
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3152	active	jhum4u2006	2012-10-03
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3150	active	jhum4u2006	2012-10-03
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3149	active	jhum4u2006	2012-10-03
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3148	active	jhum4u2006	2012-10-03
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3147	active	jhum4u2006	2012-10-03
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3146	active	jhum4u2006	2012-10-03
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3145	active	jhum4u2006	2012-10-03
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3151	active	jhum4u2006	2012-10-03
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3151	active	jhum4u2006	2012-10-03
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3151	active	jhum4u2006	2012-10-03
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3151	active	jhum4u2006	2012-10-03
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3151	active	jhum4u2006	2012-10-03
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3150	active	jhum4u2006	2012-10-03
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3150	active	jhum4u2006	2012-10-03
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3150	active	jhum4u2006	2012-10-03
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3150	active	jhum4u2006	2012-10-03
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3150	active	jhum4u2006	2012-10-03
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3149	active	jhum4u2006	2012-10-03
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3149	active	jhum4u2006	2012-10-03
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3149	active	jhum4u2006	2012-10-03
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3149	active	jhum4u2006	2012-10-03
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3149	active	jhum4u2006	2012-10-03
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3148	active	jhum4u2006	2012-10-03
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3148	active	jhum4u2006	2012-10-03
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3148	active	jhum4u2006	2012-10-03
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3148	active	jhum4u2006	2012-10-03
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3148	active	jhum4u2006	2012-10-03
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3147	active	jhum4u2006	2012-10-03
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3147	active	jhum4u2006	2012-10-03
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3147	active	jhum4u2006	2012-10-03
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3147	active	jhum4u2006	2012-10-03
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3147	active	jhum4u2006	2012-10-03
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3146	active	jhum4u2006	2012-10-03
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3146	active	jhum4u2006	2012-10-03
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3146	active	jhum4u2006	2012-10-03
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3146	active	jhum4u2006	2012-10-03
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3146	active	jhum4u2006	2012-10-03
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3145	active	jhum4u2006	2012-10-03
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3145	active	jhum4u2006	2012-10-03
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3145	active	jhum4u2006	2012-10-03
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3145	active	jhum4u2006	2012-10-03
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3145	active	jhum4u2006	2012-10-03
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976