Rv3158 - NADH dehydrogenase I chain N nuoN

Expression: Most Significant Conditions for Rv3158

Protein Domains

Gene Information
Locus	Rv3158
Symbol	nuoN
Gene Name	NADH dehydrogenase I chain N nuoN
Location	3525790 - 3527385 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:1596 bp Protein:532 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	30121
Related Genes	Acel_0280 MAP3214 MAV_4047 Mkms_1588 Mmcs_1564 MSMEG_2050 MT3246 MUL_2472 Mvan_1872 nfa26550 SAV4850
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv3158
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv3158 Transcript 1
MILPAPHVEYFLLAPMLIVFSVAVAGVLAEAFLPRRWRYGAQVTLALGGSAVALIAVIVV
ARSIHGSGHAAVLGAIAVDRATLFLQGTVLLVTIMAVVFMAERSARVSPQRQNTLAVARL
PGLDSFTPQASAVPGSDAERQAERAGATQTELFPLAMLSVGGMMVFPASNDLLTMFVALE
VLSLPLYLMCGLARNRRLLSQEAAMKYFLLGAFSSAFFLYGVALLYGATGTLTLPGIRDA
LAARTDDSMALAGVALLAVGLLFKVGAVPFHSWIPDVYQGAPTPITGFMAAATKVAAFGA
LLRVVYVALPPLHDQWRPVLWAIAILTMTVGTVTAVNQTNVKRMLAYSSVAHVGFILTGV
IADNPAGLSATLFYLVAYSFSTMGAFAIVGLVRGADGSAGSEDADLSHWAGLGQRSPIVG
VMLSMFLLAFAGIPLTSGFVSKFAVFRAAASAGAVPLVIVGVISSGVAAYFYVRVIVSMF
FTEESGDTPHVAAPGVLSKAAIAVCTVVTVVLGIAPQPVLDLADQAAQLLR*

Genomic Sequence

>Rv3158
ATGATCCTGCCCGCCCCGCACGTCGAGTACTTCCTGCTCGCTCCGATGCTCATCGTCTTT
TCGGTTGCGGTCGCCGGTGTGCTGGCCGAGGCTTTCCTGCCGCGCCGGTGGCGCTATGGC
GCCCAAGTGACGCTCGCCCTTGGCGGGTCGGCAGTGGCACTCATCGCGGTCATCGTGGTG
GCCAGGTCGATTCACGGGTCGGGTCACGCCGCGGTGCTGGGGGCCATAGCCGTGGATCGA
GCGACCCTGTTTCTGCAAGGCACCGTACTACTGGTCACGATCATGGCAGTCGTCTTCATG
GCCGAACGCAGCGCCCGGGTGAGTCCGCAACGCCAGAACACCCTCGCTGTGGCGCGGCTC
CCTGGACTCGATTCGTTTACCCCGCAGGCTTCCGCCGTGCCCGGCAGCGATGCTGAGCGC
CAAGCGGAACGGGCGGGAGCCACCCAGACGGAACTTTTCCCGCTGGCGATGCTGTCCGTC
GGCGGCATGATGGTGTTTCCCGCGTCCAACGACCTGTTGACGATGTTCGTTGCGCTGGAG
GTGCTATCGCTGCCGCTGTACCTGATGTGTGGGCTGGCCCGGAATCGCCGCCTGCTGTCG
CAGGAAGCCGCGATGAAGTACTTCCTGCTGGGCGCCTTCTCGTCGGCGTTCTTCCTCTAC
GGCGTCGCGTTGCTATACGGCGCGACCGGCACGCTGACCTTGCCGGGTATTCGGGATGCG
TTGGCAGCGCGCACCGACGACTCAATGGCGTTGGCCGGCGTCGCGCTGCTCGCGGTCGGC
CTACTATTCAAGGTCGGCGCGGTGCCATTCCACTCCTGGATTCCCGATGTGTACCAGGGC
GCACCCACCCCGATCACCGGGTTCATGGCGGCCGCCACCAAGGTCGCGGCGTTCGGTGCG
CTGCTCCGGGTGGTCTATGTCGCGCTGCCGCCGCTGCACGATCAGTGGCGCCCGGTGCTG
TGGGCGATTGCCATCCTCACCATGACGGTGGGCACCGTCACCGCGGTAAACCAGACCAAC
GTCAAGCGTATGCTGGCCTATTCATCGGTCGCGCACGTCGGTTTCATACTTACCGGCGTG
ATCGCCGATAATCCGGCGGGTCTTTCCGCGACGTTGTTCTATCTGGTCGCCTACAGCTTC
AGCACGATGGGTGCGTTTGCCATCGTGGGTCTGGTCCGAGGCGCCGACGGCTCAGCAGGT
TCAGAGGATGCCGACCTGTCCCACTGGGCCGGGCTGGGACAGCGTTCACCTATCGTGGGC
GTGATGCTGTCGATGTTTCTGCTGGCCTTCGCCGGCATCCCGTTGACCAGTGGATTCGTC
AGCAAGTTCGCGGTGTTTAGGGCCGCCGCTTCCGCCGGCGCGGTGCCGCTGGTAATCGTC
GGCGTGATCTCCAGCGGCGTCGCCGCCTACTTCTACGTGCGGGTGATCGTGAGCATGTTC
TTCACCGAAGAATCCGGTGACACACCACACGTGGCGGCACCCGGCGTGCTGAGCAAGGCC
GCCATTGCGGTATGCACGGTAGTCACCGTGGTGCTGGGGATCGCCCCGCAGCCGGTGCTC
GACCTGGCCGACCAGGCCGCCCAGTTGCTGCGCTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	PhysicalInteraction Rv3158	active	jhum4u2006	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3158	active	jhum4u2006	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3157	active	jhum4u2006	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3156	active	jhum4u2006	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3155	active	jhum4u2006	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3154	active	jhum4u2006	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3153	active	jhum4u2006	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3152	active	jhum4u2006	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3150	active	jhum4u2006	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3149	active	jhum4u2006	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3148	active	jhum4u2006	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3147	active	jhum4u2006	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3146	active	jhum4u2006	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3145	active	jhum4u2006	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3158	active	jhum4u2006	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3158	active	jhum4u2006	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3157	active	jhum4u2006	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3156	active	jhum4u2006	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3155	active	jhum4u2006	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3154	active	jhum4u2006	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3153	active	jhum4u2006	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3152	active	jhum4u2006	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3150	active	jhum4u2006	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3149	active	jhum4u2006	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3148	active	jhum4u2006	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3147	active	jhum4u2006	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3146	active	jhum4u2006	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3145	active	jhum4u2006	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3158	active	jhum4u2006	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3158	active	jhum4u2006	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3157	active	jhum4u2006	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3156	active	jhum4u2006	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3155	active	jhum4u2006	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3154	active	jhum4u2006	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3153	active	jhum4u2006	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3152	active	jhum4u2006	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3150	active	jhum4u2006	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3149	active	jhum4u2006	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3148	active	jhum4u2006	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3147	active	jhum4u2006	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3146	active	jhum4u2006	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3145	active	jhum4u2006	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3158	active	jhum4u2006	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3158	active	jhum4u2006	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3157	active	jhum4u2006	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3156	active	jhum4u2006	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3155	active	jhum4u2006	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3154	active	jhum4u2006	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3153	active	jhum4u2006	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3152	active	jhum4u2006	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3150	active	jhum4u2006	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3149	active	jhum4u2006	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3148	active	jhum4u2006	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3147	active	jhum4u2006	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3146	active	jhum4u2006	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3145	active	jhum4u2006	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3158	active	jhum4u2006	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3158	active	jhum4u2006	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3157	active	jhum4u2006	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3156	active	jhum4u2006	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3155	active	jhum4u2006	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3154	active	jhum4u2006	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3153	active	jhum4u2006	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3152	active	jhum4u2006	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3150	active	jhum4u2006	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3149	active	jhum4u2006	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3148	active	jhum4u2006	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3147	active	jhum4u2006	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3146	active	jhum4u2006	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3145	active	jhum4u2006	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3158	active	hibeeluck	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3158	active	hibeeluck	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3157	active	hibeeluck	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3156	active	hibeeluck	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3155	active	hibeeluck	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3154	active	hibeeluck	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3153	active	hibeeluck	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3152	active	hibeeluck	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3150	active	hibeeluck	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3149	active	hibeeluck	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3148	active	hibeeluck	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3147	active	hibeeluck	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3146	active	hibeeluck	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3145	active	hibeeluck	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3158	active	hibeeluck	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3158	active	hibeeluck	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3157	active	hibeeluck	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3156	active	hibeeluck	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3155	active	hibeeluck	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3154	active	hibeeluck	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3153	active	hibeeluck	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3152	active	hibeeluck	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3150	active	hibeeluck	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3149	active	hibeeluck	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3148	active	hibeeluck	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3147	active	hibeeluck	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3146	active	hibeeluck	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3145	active	hibeeluck	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3158	active	hibeeluck	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3158	active	hibeeluck	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3157	active	hibeeluck	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3156	active	hibeeluck	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3155	active	hibeeluck	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3154	active	hibeeluck	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3153	active	hibeeluck	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3152	active	hibeeluck	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3150	active	hibeeluck	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3149	active	hibeeluck	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3148	active	hibeeluck	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3147	active	hibeeluck	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3146	active	hibeeluck	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3145	active	hibeeluck	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3158	active	hibeeluck	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3158	active	hibeeluck	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3157	active	hibeeluck	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3156	active	hibeeluck	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3155	active	hibeeluck	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3154	active	hibeeluck	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3153	active	hibeeluck	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3152	active	hibeeluck	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3150	active	hibeeluck	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3149	active	hibeeluck	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3148	active	hibeeluck	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3147	active	hibeeluck	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3146	active	hibeeluck	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3145	active	hibeeluck	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3158	active	hibeeluck	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3158	active	hibeeluck	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3157	active	hibeeluck	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3156	active	hibeeluck	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3155	active	hibeeluck	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3154	active	hibeeluck	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3153	active	hibeeluck	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3152	active	hibeeluck	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3150	active	hibeeluck	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3149	active	hibeeluck	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3148	active	hibeeluck	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3147	active	hibeeluck	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3146	active	hibeeluck	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3145	active	hibeeluck	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3157	active	jhum4u2006	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3157	active	jhum4u2006	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3157	active	jhum4u2006	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3157	active	jhum4u2006	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3157	active	jhum4u2006	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3157	active	hibeeluck	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3157	active	hibeeluck	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3157	active	hibeeluck	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3157	active	hibeeluck	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3157	active	hibeeluck	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3156	active	jhum4u2006	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3156	active	jhum4u2006	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3156	active	jhum4u2006	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3156	active	jhum4u2006	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3156	active	jhum4u2006	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3156	active	hibeeluck	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3156	active	hibeeluck	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3156	active	hibeeluck	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3156	active	hibeeluck	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3156	active	hibeeluck	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3155	active	jhum4u2006	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3155	active	jhum4u2006	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3155	active	jhum4u2006	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3155	active	jhum4u2006	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3155	active	jhum4u2006	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3155	active	hibeeluck	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3155	active	hibeeluck	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3155	active	hibeeluck	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3155	active	hibeeluck	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3155	active	hibeeluck	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3154	active	jhum4u2006	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3154	active	jhum4u2006	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3154	active	jhum4u2006	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3154	active	jhum4u2006	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3154	active	jhum4u2006	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3154	active	hibeeluck	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3154	active	hibeeluck	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3154	active	hibeeluck	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3154	active	hibeeluck	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3154	active	hibeeluck	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3153	active	jhum4u2006	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3153	active	jhum4u2006	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3153	active	jhum4u2006	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3153	active	jhum4u2006	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3153	active	jhum4u2006	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3153	active	hibeeluck	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3153	active	hibeeluck	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3153	active	hibeeluck	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3153	active	hibeeluck	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3153	active	hibeeluck	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3152	active	jhum4u2006	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3152	active	jhum4u2006	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3152	active	jhum4u2006	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3152	active	jhum4u2006	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3152	active	jhum4u2006	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3152	active	hibeeluck	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3152	active	hibeeluck	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3152	active	hibeeluck	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3152	active	hibeeluck	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3152	active	hibeeluck	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3151	active	jhum4u2006	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3151	active	jhum4u2006	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3151	active	jhum4u2006	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3151	active	jhum4u2006	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3151	active	jhum4u2006	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3151	active	hibeeluck	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3151	active	hibeeluck	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3151	active	hibeeluck	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3151	active	hibeeluck	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3151	active	hibeeluck	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3150	active	jhum4u2006	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3150	active	jhum4u2006	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3150	active	jhum4u2006	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3150	active	jhum4u2006	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3150	active	jhum4u2006	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3150	active	hibeeluck	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3150	active	hibeeluck	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3150	active	hibeeluck	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3150	active	hibeeluck	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3150	active	hibeeluck	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3149	active	jhum4u2006	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3149	active	jhum4u2006	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3149	active	jhum4u2006	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3149	active	jhum4u2006	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3149	active	jhum4u2006	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3149	active	hibeeluck	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3149	active	hibeeluck	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3149	active	hibeeluck	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3149	active	hibeeluck	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3149	active	hibeeluck	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3148	active	jhum4u2006	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3148	active	jhum4u2006	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3148	active	jhum4u2006	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3148	active	jhum4u2006	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3148	active	jhum4u2006	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3148	active	hibeeluck	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3148	active	hibeeluck	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3148	active	hibeeluck	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3148	active	hibeeluck	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3148	active	hibeeluck	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3147	active	jhum4u2006	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3147	active	jhum4u2006	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3147	active	jhum4u2006	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3147	active	jhum4u2006	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3147	active	jhum4u2006	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3147	active	hibeeluck	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3147	active	hibeeluck	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3147	active	hibeeluck	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3147	active	hibeeluck	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3147	active	hibeeluck	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3146	active	jhum4u2006	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3146	active	jhum4u2006	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3146	active	jhum4u2006	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3146	active	jhum4u2006	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3146	active	jhum4u2006	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3146	active	hibeeluck	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3146	active	hibeeluck	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3146	active	hibeeluck	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3146	active	hibeeluck	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3146	active	hibeeluck	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3145	active	jhum4u2006	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3145	active	jhum4u2006	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3145	active	jhum4u2006	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3145	active	jhum4u2006	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3145	active	jhum4u2006	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3145	active	hibeeluck	2012-10-05
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3145	active	hibeeluck	2012-10-05
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3145	active	hibeeluck	2012-10-05
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3145	active	hibeeluck	2012-10-05
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3145	active	hibeeluck	2012-10-05
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3158	active	jhum4u2006	2012-10-03
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3158	active	jhum4u2006	2012-10-03
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3157	active	jhum4u2006	2012-10-03
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3156	active	jhum4u2006	2012-10-03
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3155	active	jhum4u2006	2012-10-03
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3154	active	jhum4u2006	2012-10-03
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3153	active	jhum4u2006	2012-10-03
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3152	active	jhum4u2006	2012-10-03
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3150	active	jhum4u2006	2012-10-03
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3149	active	jhum4u2006	2012-10-03
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3148	active	jhum4u2006	2012-10-03
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3147	active	jhum4u2006	2012-10-03
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3146	active	jhum4u2006	2012-10-03
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3145	active	jhum4u2006	2012-10-03
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3158	active	jhum4u2006	2012-10-03
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3158	active	jhum4u2006	2012-10-03
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3157	active	jhum4u2006	2012-10-03
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3156	active	jhum4u2006	2012-10-03
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3155	active	jhum4u2006	2012-10-03
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3154	active	jhum4u2006	2012-10-03
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3153	active	jhum4u2006	2012-10-03
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3152	active	jhum4u2006	2012-10-03
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3150	active	jhum4u2006	2012-10-03
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3149	active	jhum4u2006	2012-10-03
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3148	active	jhum4u2006	2012-10-03
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3147	active	jhum4u2006	2012-10-03
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3146	active	jhum4u2006	2012-10-03
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3145	active	jhum4u2006	2012-10-03
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3158	active	jhum4u2006	2012-10-03
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3158	active	jhum4u2006	2012-10-03
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3157	active	jhum4u2006	2012-10-03
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3156	active	jhum4u2006	2012-10-03
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3155	active	jhum4u2006	2012-10-03
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3154	active	jhum4u2006	2012-10-03
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3153	active	jhum4u2006	2012-10-03
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3152	active	jhum4u2006	2012-10-03
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3150	active	jhum4u2006	2012-10-03
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3149	active	jhum4u2006	2012-10-03
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3148	active	jhum4u2006	2012-10-03
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3147	active	jhum4u2006	2012-10-03
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3146	active	jhum4u2006	2012-10-03
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3145	active	jhum4u2006	2012-10-03
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3158	active	jhum4u2006	2012-10-03
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3158	active	jhum4u2006	2012-10-03
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3157	active	jhum4u2006	2012-10-03
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3156	active	jhum4u2006	2012-10-03
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3155	active	jhum4u2006	2012-10-03
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3154	active	jhum4u2006	2012-10-03
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3153	active	jhum4u2006	2012-10-03
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3152	active	jhum4u2006	2012-10-03
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3150	active	jhum4u2006	2012-10-03
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3149	active	jhum4u2006	2012-10-03
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3148	active	jhum4u2006	2012-10-03
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3147	active	jhum4u2006	2012-10-03
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3146	active	jhum4u2006	2012-10-03
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3145	active	jhum4u2006	2012-10-03
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3158	active	jhum4u2006	2012-10-03
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3158	active	jhum4u2006	2012-10-03
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3157	active	jhum4u2006	2012-10-03
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3156	active	jhum4u2006	2012-10-03
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3155	active	jhum4u2006	2012-10-03
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3154	active	jhum4u2006	2012-10-03
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3153	active	jhum4u2006	2012-10-03
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3152	active	jhum4u2006	2012-10-03
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3150	active	jhum4u2006	2012-10-03
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3149	active	jhum4u2006	2012-10-03
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3148	active	jhum4u2006	2012-10-03
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3147	active	jhum4u2006	2012-10-03
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3146	active	jhum4u2006	2012-10-03
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3145	active	jhum4u2006	2012-10-03
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3157	active	jhum4u2006	2012-10-03
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3157	active	jhum4u2006	2012-10-03
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3157	active	jhum4u2006	2012-10-03
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3157	active	jhum4u2006	2012-10-03
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3157	active	jhum4u2006	2012-10-03
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3156	active	jhum4u2006	2012-10-03
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3156	active	jhum4u2006	2012-10-03
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3156	active	jhum4u2006	2012-10-03
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3156	active	jhum4u2006	2012-10-03
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3156	active	jhum4u2006	2012-10-03
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3155	active	jhum4u2006	2012-10-03
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3155	active	jhum4u2006	2012-10-03
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3155	active	jhum4u2006	2012-10-03
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3155	active	jhum4u2006	2012-10-03
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3155	active	jhum4u2006	2012-10-03
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3154	active	jhum4u2006	2012-10-03
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3154	active	jhum4u2006	2012-10-03
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3154	active	jhum4u2006	2012-10-03
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3154	active	jhum4u2006	2012-10-03
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3154	active	jhum4u2006	2012-10-03
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3153	active	jhum4u2006	2012-10-03
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3153	active	jhum4u2006	2012-10-03
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3153	active	jhum4u2006	2012-10-03
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3153	active	jhum4u2006	2012-10-03
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3153	active	jhum4u2006	2012-10-03
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3152	active	jhum4u2006	2012-10-03
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3152	active	jhum4u2006	2012-10-03
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3152	active	jhum4u2006	2012-10-03
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3152	active	jhum4u2006	2012-10-03
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3152	active	jhum4u2006	2012-10-03
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3151	active	jhum4u2006	2012-10-03
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3151	active	jhum4u2006	2012-10-03
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3151	active	jhum4u2006	2012-10-03
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3151	active	jhum4u2006	2012-10-03
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3151	active	jhum4u2006	2012-10-03
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3150	active	jhum4u2006	2012-10-03
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3150	active	jhum4u2006	2012-10-03
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3150	active	jhum4u2006	2012-10-03
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3150	active	jhum4u2006	2012-10-03
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3150	active	jhum4u2006	2012-10-03
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3149	active	jhum4u2006	2012-10-03
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3149	active	jhum4u2006	2012-10-03
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3149	active	jhum4u2006	2012-10-03
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3149	active	jhum4u2006	2012-10-03
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3149	active	jhum4u2006	2012-10-03
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3148	active	jhum4u2006	2012-10-03
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3148	active	jhum4u2006	2012-10-03
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3148	active	jhum4u2006	2012-10-03
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3148	active	jhum4u2006	2012-10-03
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3148	active	jhum4u2006	2012-10-03
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3147	active	jhum4u2006	2012-10-03
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3147	active	jhum4u2006	2012-10-03
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3147	active	jhum4u2006	2012-10-03
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3147	active	jhum4u2006	2012-10-03
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3147	active	jhum4u2006	2012-10-03
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3146	active	jhum4u2006	2012-10-03
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3146	active	jhum4u2006	2012-10-03
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3146	active	jhum4u2006	2012-10-03
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3146	active	jhum4u2006	2012-10-03
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3146	active	jhum4u2006	2012-10-03
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976
Interaction	PhysicalInteraction Rv3145	active	jhum4u2006	2012-10-03
	authors,T. Friedrich,B. Böttcher The gross structure of the respiratory complex I: a Lego System. Biochim. Biophys. Acta 2004
Interaction	PhysicalInteraction Rv3145	active	jhum4u2006	2012-10-03
	authors,P. Golby,KA. Hatch,J. Bacon,R. Cooney,P. Riley,J. Allnutt,J. Hinds,J. Nunez,PD. Marsh,RG. Hewinson,SV. Gordon Comparative transcriptomics reveals key gene expression differences between the human and bovine pathogens of the Mycobacterium tuberculosis complex. Microbiology (Reading, Engl.) 2007
Interaction	PhysicalInteraction Rv3145	active	jhum4u2006	2012-10-03
	authors,LS. Meena,null. Rajni Survival mechanisms of pathogenic Mycobacterium tuberculosis H37Rv. FEBS J. 2010
Interaction	PhysicalInteraction Rv3145	active	jhum4u2006	2012-10-03
	authors,LM. Fu,CS. Fu-Liu The gene expression data of Mycobacterium tuberculosis based on Affymetrix gene chips provide insight into regulatory and hypothetical genes. BMC Microbiol. 2007
Interaction	PhysicalInteraction Rv3145	active	jhum4u2006	2012-10-03
	authors,GF. Dancey,AE. Levine,BM. Shapiro The NADH dehydrogenase of the respiratory chain of Escherichia coli. I. Properties of the membrane-bound enzyme, its solubilization, and purification to near homogeneity. J. Biol. Chem. 1976