Rv3219 - transcriptional regulator whib-like whiB1

Expression: Most Significant Conditions for Rv3219

Protein Domains

Gene Information
Locus	Rv3219
Symbol	whiB1
Gene Name	transcriptional regulator whib-like whiB1
Location	3595713 - 3595967 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:255 bp Protein:85 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	33795
Related Genes	Acel_0560 CE0783 cg0878 DIP0712 jk1618 MAP3320 MAV_4167 Mkms_1401 ML0804 Mmcs_1383 MSMEG_1919 MT3315 MUL_2541 Mvan_1782 nfa45800 PPA1264 SAV3016
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv3219
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv3219 Transcript 1
MDWRHKAVCRDEDPELFFPVGNSGPALAQIADAKLVCNRCPVTTECLSWALNTGQDSGVW
GGMSEDERRALKRRNARTKARTGV*

Genomic Sequence

>Rv3219
ATGGATTGGCGCCACAAGGCGGTCTGTCGTGACGAGGATCCGGAACTGTTCTTCCCGGTA
GGAAACAGTGGTCCGGCACTTGCGCAGATCGCTGACGCGAAACTGGTCTGTAATCGGTGC
CCGGTCACCACAGAGTGCCTCAGCTGGGCACTGAATACCGGCCAGGACTCGGGCGTCTGG
GGAGGCATGAGCGAAGACGAGCGGCGCGCGCTGAAGCGTCGCAACGCCCGCACGAAAGCC
CGTACCGGGGTCTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	PhysicalInteraction Rv1326c	active	sourish10	2012-10-05
	Yeast two-hybrid (Physical interaction) SK. Garg, MS. Alam et al. Redox Biology of Mycobacterium tuberculosis H37Rv: protein-protein interaction between GlgB and WhiB1 involves exchange of thiol-disulfide. BMC Biochem. 2009
Interaction	PhysicalInteraction Rv1326c	active	ahal4789	2012-10-05
	Yeast two-hybrid (Physical interaction) SK. Garg, MS. Alam et al. Redox Biology of Mycobacterium tuberculosis H37Rv: protein-protein interaction between GlgB and WhiB1 involves exchange of thiol-disulfide. BMC Biochem. 2009
Interaction	RegulatedBy Rv0757	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. SB. Walters, E. Dubnau et al. The Mycobacterium tuberculosis PhoPR two-component system regulates genes essential for virulence and complex lipid biosynthesis. Mol. Microbiol. 2006
Interaction	RegulatedBy Rv1221	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. R. Manganelli, MI. Voskuil et al. The Mycobacterium tuberculosis ECF sigma factor sigmaE: role in global gene expression and survival in macrophages. Mol. Microbiol. 2001
Interaction	RegulatedBy Rv3676	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008