Rv3249c - transcriptional regulator, tetR-family

Expression: Most Significant Conditions for Rv3249c

Protein Domains

Gene Information
Locus	Rv3249c
Symbol
Gene Name	transcriptional regulator, tetR-family
Location	3629752 - 3630387 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:636 bp Protein:212 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	19407
Related Genes	MAV_4212 Mkms_1353 Mmcs_1335 MSMEG_1842 MT3347 MUL_2593 Mvan_1745 nfa46150
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv3249c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv3249c Transcript 1
MSTPSATVAPVKRIPYAEASRALLRDSVLDAMRDLLLTRDWSAITLSDVARAAGISRQTI
YNEFGSRQGLAQGYALRLADRLVDNVHASLDANVGNFYEAFLQGFRSFFAESAADPLVIS
LLTGVAKPDLLQLITTDSAPIITRASARLAPAFTDTWVATTDNDANVLSRAIVRLCLSYV
SMPPEADHDVAADLARLITPFAERHGVINVP*

Genomic Sequence

>Rv3249c
GTGAGCACTCCAAGCGCTACTGTCGCGCCTGTGAAGCGGATACCCTATGCCGAGGCCTCG
CGGGCCCTGTTGCGGGATTCGGTGCTGGATGCGATGCGGGATCTGCTGCTGACCCGCGAC
TGGTCCGCCATCACGCTGTCCGACGTGGCCCGCGCGGCGGGCATCAGCCGGCAGACCATC
TACAACGAATTCGGTTCCCGGCAAGGCCTGGCGCAGGGATACGCGCTGCGCCTGGCCGAC
CGATTAGTGGACAACGTCCATGCATCGTTGGACGCCAACGTCGGCAACTTTTACGAAGCG
TTCCTGCAGGGCTTTCGGTCGTTCTTCGCCGAGTCGGCGGCAGATCCGTTGGTCATCTCG
CTGTTGACCGGTGTCGCCAAGCCCGATCTGCTGCAACTGATCACCACCGACAGCGCGCCG
ATCATCACCCGCGCGTCGGCCCGGCTGGCGCCGGCCTTCACCGATACCTGGGTGGCCACC
ACCGATAACGACGCCAATGTGCTCTCGCGTGCGATCGTGCGGCTGTGCTTGAGCTACGTG
TCGATGCCGCCCGAGGCCGACCATGATGTCGCAGCGGACCTAGCACGGCTAATAACGCCG
TTCGCGGAGCGTCACGGTGTGATCAATGTCCCCTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Regulatory Rv2150c	active	shahanup86	2012-10-05
	ChIP (Physical interaction) RA. Slayden, DL. Knudson et al. Identification of cell cycle regulators in Mycobacterium tuberculosis by inhibition of septum formation and global transcriptional analysis. Microbiology (Reading, Engl.) 2006
Interaction	RegulatedBy Rv3681c	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv1956	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv1359	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv0818	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009
Interaction	RegulatedBy Rv0491	active	yamir.moreno	2012-10-05
	One hybrid reporter system. Physical binding of the regulator to the regulated promoter proved by using electrophoretic mobility shift assay. . M. Guo, H. Feng et al. Dissecting transcription regulatory pathways through a new bacterial one-hybrid reporter system. Genome Res. 2009