Rv3358 - conserved hypothetical protein

Expression: Most Significant Conditions for Rv3358

Protein Domains

Gene Information
Locus	Rv3358
Symbol
Gene Name	conserved hypothetical protein
Location	3771045 - 3771302 (+)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:258 bp Protein:86 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	2255
Related Genes	jk0894 MT3466 SAV3205
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv3358
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv3358 Transcript 1
MRSVNFDPDAWEDFLFWLAADRKTARRITRLIGEIQRDPFSGIGKPEPLQGELSGYWSRR
IDDEHRLVYRAGDDEVTMLKARYHY*

Genomic Sequence

>Rv3358
GTGAGAAGCGTCAACTTCGATCCCGATGCCTGGGAGGACTTCTTGTTCTGGCTGGCCGCT
GATCGCAAAACGGCCCGTCGGATCACCCGGTTGATCGGAGAAATTCAGCGTGATCCGTTC
AGCGGGATCGGCAAACCCGAGCCGCTCCAAGGTGAGTTGTCGGGATACTGGTCGCGCCGG
ATCGACGACGAACACCGGCTGGTGTATCGAGCGGGCGACGACGAAGTCACGATGCTGAAG
GCCCGATACCACTACTGA

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	PhysicalInteraction Rv3357	active	vashishtrv	2012-10-05
	Affinity purification (Physical interaction) authors,R. Singh,CE. Barry,HI. Boshoff The three RelE homologs of Mycobacterium tuberculosis have individual, drug-specific effects on bacterial antibiotic tolerance. J. Bacteriol. 2010
Interaction	PhysicalInteraction Rv3357	active	vashishtrv	2012-10-05
	Affinity purification (Physical interaction) SB. Korch, H. Contreras et al. Three Mycobacterium tuberculosis Rel toxin:antitoxin modules inhibit mycobacterial growth and are expressed in human-infected macrophages. J. Bacteriol. 2008
Interaction	PhysicalInteraction Rv3357	active	vashishtrv	2012-10-05
	Affinity purification (Physical interaction) authors,P. Kumar,B. Issac,EJ. Dodson,JP. Turkenburg,SC. Mande Crystal structure of Mycobacterium tuberculosis YefM antitoxin reveals that it is not an intrinsically unstructured protein. J. Mol. Biol. 2008
Interaction	PhysicalInteraction Rv3357	active	shahanup86	2012-10-05
	Affinity purification (Physical interaction) authors,R. Singh,CE. Barry,HI. Boshoff The three RelE homologs of Mycobacterium tuberculosis have individual, drug-specific effects on bacterial antibiotic tolerance. J. Bacteriol. 2010
Interaction	PhysicalInteraction Rv3357	active	shahanup86	2012-10-05
	Affinity purification (Physical interaction) SB. Korch, H. Contreras et al. Three Mycobacterium tuberculosis Rel toxin:antitoxin modules inhibit mycobacterial growth and are expressed in human-infected macrophages. J. Bacteriol. 2008
Interaction	PhysicalInteraction Rv3357	active	shahanup86	2012-10-05
	Affinity purification (Physical interaction) authors,P. Kumar,B. Issac,EJ. Dodson,JP. Turkenburg,SC. Mande Crystal structure of Mycobacterium tuberculosis YefM antitoxin reveals that it is not an intrinsically unstructured protein. J. Mol. Biol. 2008
Interaction	PhysicalInteraction Rv3357	active	vashishtrv	2012-10-05
	Affinity purification (Physical interaction) authors,R. Singh,CE. Barry,HI. Boshoff The three RelE homologs of Mycobacterium tuberculosis have individual, drug-specific effects on bacterial antibiotic tolerance. J. Bacteriol. 2010
Interaction	PhysicalInteraction Rv3357	active	vashishtrv	2012-10-05
	Affinity purification (Physical interaction) SB. Korch, H. Contreras et al. Three Mycobacterium tuberculosis Rel toxin:antitoxin modules inhibit mycobacterial growth and are expressed in human-infected macrophages. J. Bacteriol. 2008
Interaction	PhysicalInteraction Rv3357	active	vashishtrv	2012-10-05
	Affinity purification (Physical interaction) authors,P. Kumar,B. Issac,EJ. Dodson,JP. Turkenburg,SC. Mande Crystal structure of Mycobacterium tuberculosis YefM antitoxin reveals that it is not an intrinsically unstructured protein. J. Mol. Biol. 2008
Interaction	PhysicalInteraction Rv3357	active	shahanup86	2012-10-05
	Affinity purification (Physical interaction) authors,R. Singh,CE. Barry,HI. Boshoff The three RelE homologs of Mycobacterium tuberculosis have individual, drug-specific effects on bacterial antibiotic tolerance. J. Bacteriol. 2010
Interaction	PhysicalInteraction Rv3357	active	shahanup86	2012-10-05
	Affinity purification (Physical interaction) SB. Korch, H. Contreras et al. Three Mycobacterium tuberculosis Rel toxin:antitoxin modules inhibit mycobacterial growth and are expressed in human-infected macrophages. J. Bacteriol. 2008
Interaction	PhysicalInteraction Rv3357	active	shahanup86	2012-10-05
	Affinity purification (Physical interaction) authors,P. Kumar,B. Issac,EJ. Dodson,JP. Turkenburg,SC. Mande Crystal structure of Mycobacterium tuberculosis YefM antitoxin reveals that it is not an intrinsically unstructured protein. J. Mol. Biol. 2008
Symbol	relK	active	jlew	2012-03-07
	Each pair shows interaction by two-hybrid and GST pulldown. F and B each interact with E, G, K, and itself. authors,M. Yang,C. Gao,Y. Wang,H. Zhang,ZG. He Characterization of the interaction and cross-regulation of three Mycobacterium tuberculosis RelBE modules. PLoS ONE 2010
Symbol	relE3	active	jlew	2012-03-07
	Each toxin individually arrests growth of both M. tuberculosis and E. coli, an effect that is neutralized by coexpression of the cognate antitoxin. authors,R. Singh,CE. Barry,HI. Boshoff The three RelE homologs of Mycobacterium tuberculosis have individual, drug-specific effects on bacterial antibiotic tolerance. J. Bacteriol. 2010
Symbol	relK	active	jlew	2012-03-07
	Overexpression of Mtb relE, relG and relK induces growth arrest in Msmeg; reversed by expression of relB, relF and relJ SB. Korch, H. Contreras et al. Three Mycobacterium tuberculosis Rel toxin:antitoxin modules inhibit mycobacterial growth and are expressed in human-infected macrophages. J. Bacteriol. 2008
Symbol	RelE3	active	jlew	2012-03-07
	We report the heterologous toxicity of these TA loci in Escherichia coli and show that only a few of the M. tuberculosis-encoded toxins can inhibit E. coli growth and have a killing effect. This killing effect can be suppressed by coexpression of the cognate antitoxin. authors,A. Gupta Killing activity and rescue function of genome-wide toxin-antitoxin loci of Mycobacterium tuberculosis. FEMS Microbiol. Lett. 2009
Other	strand:+	active	rslayden	2012-03-05
	SAV2407 from Staphylococcus aureus subsp. aureus Mu50 (88 aa), FASTA scores: opt: 250, E(): 2e-11, (40.5% identity in 84 aa overlap); etc.
Other	stop:3771302	active	rslayden	2012-03-05
	SAV2407 from Staphylococcus aureus subsp. aureus Mu50 (88 aa), FASTA scores: opt: 250, E(): 2e-11, (40.5% identity in 84 aa overlap); etc.
Other	start:3771045	active	rslayden	2012-03-05
	SAV2407 from Staphylococcus aureus subsp. aureus Mu50 (88 aa), FASTA scores: opt: 250, E(): 2e-11, (40.5% identity in 84 aa overlap); etc.
Other	strand:+	active	rslayden	2012-03-05
	YOEB_ECOLI from Escherichia coli (84 aa), FASTA scores: opt: 305, E(): 2.2e-15, (49.35% identity in 77 aa overlap); Q9Z5W7 PUTATIVE DOC PROTEIN from Francisella novicida (68 aa), FASTA scores: opt: 253, E(): 9.6e-12, (51.6% identity in 62 aa overlap); BAB58569
Other	stop:3771302	active	rslayden	2012-03-05
	YOEB_ECOLI from Escherichia coli (84 aa), FASTA scores: opt: 305, E(): 2.2e-15, (49.35% identity in 77 aa overlap); Q9Z5W7 PUTATIVE DOC PROTEIN from Francisella novicida (68 aa), FASTA scores: opt: 253, E(): 9.6e-12, (51.6% identity in 62 aa overlap); BAB58569
Other	start:3771045	active	rslayden	2012-03-05
	YOEB_ECOLI from Escherichia coli (84 aa), FASTA scores: opt: 305, E(): 2.2e-15, (49.35% identity in 77 aa overlap); Q9Z5W7 PUTATIVE DOC PROTEIN from Francisella novicida (68 aa), FASTA scores: opt: 253, E(): 9.6e-12, (51.6% identity in 62 aa overlap); BAB58569
Other	strand:+	active	rslayden	2012-03-05
	SCBAC17D6.03 from Streptomyces coelicolor (84 aa), FASTA scores: opt: 393, E(): 1.1e-21, (59.75% identity in 82 aa overlap); P56605
Other	stop:3771302	active	rslayden	2012-03-05
	SCBAC17D6.03 from Streptomyces coelicolor (84 aa), FASTA scores: opt: 393, E(): 1.1e-21, (59.75% identity in 82 aa overlap); P56605
Other	start:3771045	active	rslayden	2012-03-05
	SCBAC17D6.03 from Streptomyces coelicolor (84 aa), FASTA scores: opt: 393, E(): 1.1e-21, (59.75% identity in 82 aa overlap); P56605
Other	strand:+	active	rslayden	2012-03-05
	Conserved hypohetical protein, highly similar to other hypohetical proteins e.g. Q9Z4V8
Other	stop:3771302	active	rslayden	2012-03-05
	Conserved hypohetical protein, highly similar to other hypohetical proteins e.g. Q9Z4V8
Other	start:3771045	active	rslayden	2012-03-05
	Conserved hypohetical protein, highly similar to other hypohetical proteins e.g. Q9Z4V8