Rv3445c - Esat-6 like protein esxU

Expression: Most Significant Conditions for Rv3445c

Protein Domains

Gene Information
Locus	Rv3445c
Symbol	esxU
Gene Name	Esat-6 like protein esxU
Location	3862947 - 3863324 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:378 bp Protein:126 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	13874
Related Genes	CE0582 cg0671 DIP0558 jk1748 MAP4243 MAV_4388 Mkms_1145 Mmcs_1128 MSMEG_1538 MT3550 MUL_0862 Mvan_1464
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv3445c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv3445c Transcript 1
MVEPGRIGGNQTRLAAVLLDVSTPNTLNADFDLMRSVAGITDARNEEIRAMLQAFIGRMS
GVPPSVWGGLAAARFQDVVDRWNAESTRLYHVLHAIADTIRHNEAALREAGQIHARHIAA
AGGDL*

Genomic Sequence

>Rv3445c
TTGGTTGAACCGGGAAGGATCGGAGGGAACCAGACGAGGTTGGCGGCGGTCCTACTTGAT
GTGAGCACACCGAACACGCTGAACGCCGACTTTGACCTGATGCGTTCGGTTGCGGGTATC
ACGGACGCCCGCAATGAGGAAATCCGTGCGATGCTGCAGGCATTCATCGGCCGCATGAGC
GGTGTGCCGCCGTCGGTGTGGGGTGGGCTCGCGGCCGCTCGGTTCCAGGATGTGGTGGAT
CGCTGGAACGCCGAGTCGACGCGGCTCTACCACGTCCTGCACGCGATCGCCGACACCATC
CGCCACAACGAGGCCGCGCTGCGGGAAGCCGGCCAAATCCATGCCCGCCACATCGCCGCC
GCCGGCGGCGACCTATAG

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Regulatory Rv3911	active	jgalag	2012-10-05
	Co-expression (Functional linkage) R. Manganelli,E. Dubnau,S. Tyagi,FR. Kramer,I. Smith Differential expression of 10 sigma factor genes in Mycobacterium tuberculosis. Mol. Microbiol. 1999
Interaction	Regulatory Rv3911	active	jgalag	2012-10-05
	Co-expression (Functional linkage) S. Raman, X. Puyang et al. Mycobacterium tuberculosis SigM positively regulates Esx secreted protein and nonribosomal peptide synthetase genes and down regulates virulence-associated surface lipid synthesis. J. Bacteriol. 2006
Interaction	Regulatory Rv3911	active	jgalag	2012-10-05
	Co-expression (Functional linkage) N. Agarwal, SC. Woolwine et al. Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. Infect. Immun. 2007
Interaction	RegulatedBy Rv3911	active	diponlove	2012-10-05
	Co-expression (Functional linkage) N. Agarwal, SC. Woolwine et al. Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. Infect. Immun. 2007
Interaction	RegulatedBy Rv3911	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. N. Agarwal, SC. Woolwine et al. Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. Infect. Immun. 2007
Interaction	RegulatedBy Rv3911	active	yamir.moreno	2012-10-05
	Microarrays. mRNA levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using microarray (or macroarray) experiments.. qRT-PCR. mRNA expression levels of regulated element measured and compared between wild-type and trans-element mutation (knockout, over expression etc.) performed by using qRT-PCR technique. N. Agarwal, SC. Woolwine et al. Characterization of the Mycobacterium tuberculosis sigma factor SigM by assessment of virulence and identification of SigM-dependent genes. Infect. Immun. 2007