Rv3503c - ferredoxin fdxD

Expression: Most Significant Conditions for Rv3503c

Protein Domains

Gene Information
Locus	Rv3503c
Symbol	fdxD
Gene Name	ferredoxin fdxD
Location	3922065 - 3922256 (-)
Species	Mycobacterium tuberculosis H37Rv complete genome.
Length	Gene:192 bp Protein:64 aa
External Links	Tuberculist Target Gene Information String Protein-Protein Interactions STITCH Chemical-Protein Interactions Search Google Scholar
Orthologs
Orthogroup Number	20728
Related Genes	MAP0560 MAV_0653 Mkms_4709 Mmcs_4621 MSMEG_5904 MT3607 MUL_4066 Mvan_5849 nfa5330
Transcriptional Regulation
Operons	View gene in operon browser
Regulatory Network	Search for regulators of Rv3503c
Expression Correlation	Genes with Correlated Expression Scatterplot of Gene Expression

Sequence

Proteins

>Rv3503c Transcript 1
MRVIVDRDRCEGNAVCLGIAPDIFDLDDEDYAVVKTDPIPVDQEDLAEQAIAECPRAALS
RGE*

Genomic Sequence

>Rv3503c
GTGCGGGTGATCGTGGACCGAGACCGATGTGAAGGCAACGCGGTGTGCTTGGGAATCGCA
CCGGATATCTTCGACCTGGACGACGAGGACTATGCCGTGGTCAAGACCGATCCGATCCCG
GTTGATCAGGAGGATCTGGCCGAGCAGGCCATCGCGGAATGCCCGCGTGCGGCGTTGTCG
CGTGGTGAGTAG

Community Annotations Pending Curatorial Review

Field	Value	Status	Creator	Date
Interaction	Regulatory Rv3574	active	priyadarshinipriyanka2001	2012-10-05
	Co-expression (Functional linkage) SL. Kendall,P. Burgess,R. Balhana,M. Withers,A. Ten Bokum,JS. Lott,C. Gao,I. Uhia Castro,NG. Stoker Cholesterol utilisation in mycobacteria is controlled by two TetR-type transcriptional regulators; kstR and kstR2. Microbiology (Reading, England) 2010
Interaction	Regulatory Rv3574	active	priyadarshinipriyanka2001	2012-10-05
	Co-expression (Functional linkage) SL. Kendall, M. Withers et al. A highly conserved transcriptional repressor controls a large regulon involved in lipid degradation in Mycobacterium smegmatis and Mycobacterium tuberculosis. Mol. Microbiol. 2007
Interaction	Regulatory Rv3574	active	jgalag	2012-10-05
	Co-expression (Functional linkage) SL. Kendall, M. Withers et al. A highly conserved transcriptional repressor controls a large regulon involved in lipid degradation in Mycobacterium smegmatis and Mycobacterium tuberculosis. Mol. Microbiol. 2007
Interaction	RegulatedBy Rv3574	active	yamir.moreno	2012-10-05
	Literature previously reported link (from Balazsi et al. 2008). Traceable author statement to experimental support. G. Balázsi, AP. Heath et al. The temporal response of the Mycobacterium tuberculosis gene regulatory network during growth arrest. Mol. Syst. Biol. 2008